Property Summary

NCBI Gene PubMed Count 22
PubMed Score 51.42
PubTator Score 41.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver diseases 87 0.0 0.0
Disease Target Count P-value
psoriasis 6694 7.4e-22
non-small cell lung cancer 2890 2.4e-19
tuberculosis 2010 3.8e-08
osteosarcoma 7950 1.7e-04
mucosa-associated lymphoid tissue lymphoma 484 8.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.434 8.1e-03
non-small cell lung cancer -1.725 2.4e-19
osteosarcoma -2.709 1.7e-04
psoriasis 1.200 7.4e-22
tuberculosis 2.200 3.8e-08

Protein-protein Interaction (3)

Gene RIF (11)

AA Sequence

MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAP      1 - 70
AVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLF     71 - 140
DFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQG    141 - 210
AYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDD    211 - 280
GALGPVLTTFDHTLDHESLNPGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLE    281 - 350
HVAEMEDPSTGAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ    351 - 420
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHRRLLEETLAPF    421 - 490
RLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLALDLGGTNFRVLLVRVTTGVQ    491 - 560
ITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFK    561 - 630
ASDCEGQDVVSLLREAITRRQAVELNVVAIVNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVA    631 - 700
GVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSL    701 - 770
GVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC    771 - 840
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALV    841 - 910
TAVACRLAQLTRV                                                             911 - 923
//

Text Mined References (24)

PMID Year Title