Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
R01 Count 3
Funding $138,758.34
PubMed Score 47.93
PubTator Score 41.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.709 0.000
tuberculosis 2.200 0.000
non-small cell lung cancer -1.725 0.000
mucosa-associated lymphoid tissue lympho... 1.434 0.008
psoriasis 1.200 0.000

Synonym

Accession P52790 Q8N1E7
Symbols HXK3
HKIII

Gene

HK3

PDB

3HM8  

Gene RIF (10)

PMID Text
26855992 HK1 and HK2 expression alterations were detected, that could be explained by common deregulation mechanisms of these genes in colorectal tumors. The HK3 expression level was significantly increased in 60% of samples.
25766729 The transport of glucose across the cell membrane by glucose transporters (GLUTs) and intracellular phosphorylation by hexokinases (HKs) are the initial steps of the glycolytic pathway.
25172542 Through glycolysis and arachidonic acid metabolism, HK3 and PTGS2 might play important roles in pediatric ALL and its prognosis, and thus, might be potential targets for therapeutic intervention to suppress pediatric ALL.
24584857 Altogether, our data provide an explanation for low HK3 and KLF5 expression in particular AML subtype and establish these genes as novel CEBPA targets during neutrophil differentiation.
22498738 HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells.
21072205 Data show that HKIII exerts protective effects against oxidative stress, perhaps by increasing ATP levels, reducing oxidant-induced ROS production, preserving mitochondrial membrane potential, and increasing mitochondrial biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of HK3 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17868400 Data demonstrated that in addition to galectin-3, HK III and cyclin A profiles could be important biomarkers in predicting malignancy in follicular thyroid nodules.

AA Sequence

MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAP      1 - 70
AVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLF     71 - 140
DFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQG    141 - 210
AYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDD    211 - 280
GALGPVLTTFDHTLDHESLNPGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLE    281 - 350
HVAEMEDPSTGAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ    351 - 420
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHRRLLEETLAPF    421 - 490
RLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLALDLGGTNFRVLLVRVTTGVQ    491 - 560
ITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFK    561 - 630
ASDCEGQDVVSLLREAITRRQAVELNVVAIVNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVA    631 - 700
GVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSL    701 - 770
GVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC    771 - 840
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALV    841 - 910
TAVACRLAQLTRV                                                             911 - 923
//

Text Mined References (23)

PMID Year Title
26855992 [Evaluation of Gene Expression of Hexokinases in Colorectal Cancer with the Use of Bioinformatics Methods].
25766729 2016 High 18F-FDG uptake in PMAH correlated with normal expression of Glut1, HK1, HK2, and HK3.
25172542 2015 Identification of key genes affecting disease free survival time of pediatric acute lymphoblastic leukemia based on bioinformatic analysis.
24584857 2014 CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.
22498738 2012 PU.1 is linking the glycolytic enzyme HK3 in neutrophil differentiation and survival of APL cells.
21072205 2010 Regulation and cytoprotective role of hexokinase III.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
17868400 2008 Hexokinase III, cyclin A and galectin-3 are overexpressed in malignant follicular thyroid nodules.
More...