Property Summary

NCBI Gene PubMed Count 103
Grant Count 177
R01 Count 101
Funding $16,642,517.44
PubMed Score 391.05
PubTator Score 330.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52789 D6W5J2 Q8WU87 Q9UN82
Symbols HKII
HXK2

Gene

HK2

PDB

2NZT   5HEX   5HFU   5HG1  

 GWAS Trait (1)

Gene RIF (79)

PMID Text
26986252 High exokinase 2 expression is associated with neuroblastoma metastasis.
26855992 HK1 and HK2 expression alterations were detected, that could be explained by common deregulation mechanisms of these genes in colorectal tumors. The HK3 expression level was significantly increased in 60% of samples.
26827442 Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity.
26802651 HK2 functions as a novel oncogene in lung cancer and may be a potential therapeutic target for lung cancer.
26740252 Cells with HKII knockdown showed no changes in 3BP sensitivity, suggesting the effects of 3BP are independent of HKII expression.
26607110 In conclusion, our findings suggested that miR-4458 inhibited the progression of colon cancer cells by inhibition of glycolysis and lactate production via directly targeting HK2 mRNA.
26346032 The degree of plaque disruption and expression of TF and HK-II appear to be important vascular factors for AMI onset, and polarized macrophages make a distinct contribution to thrombogenicity and glucose metabolism.
26323688 HK2 was identified as a chaperone-mediated autophagy substrate.
26247723 Hexokinase 2 controls cellular stress response through localization of hnRNP A1.
26134042 In the present study it was determined whether three key enzymes for glycolysis, glutaminolysis and de novo synthesis of FAs, hexokinase-2, glutaminase and fatty acid synthase
More...

AA Sequence

MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRS      1 - 70
TPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDK     71 - 140
LQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDT    141 - 210
VGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQE    211 - 280
IDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIR    281 - 350
KAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH    351 - 420
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRR    421 - 490
MKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIY    491 - 560
AIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEG    561 - 630
EDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE    631 - 700
GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRG    701 - 770
RISERLKTRGIFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA    771 - 840
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACR    841 - 910
IREAGQR                                                                   911 - 917
//

Text Mined References (105)

PMID Year Title
26986252 2016 Hexokinase 2 is a determinant of neuroblastoma metastasis.
26855992 [Evaluation of Gene Expression of Hexokinases in Colorectal Cancer with the Use of Bioinformatics Methods].
26827442 [EXPRESSION OF GENES, WHICH CONTROL GLUCOSE METABOLISM, IN BLOOD CELLS OF THE OBESE BOYS WITH INSULIN RESISTANCE].
26802651 2016 Inhibition of Lung Carcinoma A549 Cell Growth by Knockdown of Hexokinase 2 In Situ and In Vivo.
26740252 2016 The effect of 3-bromopyruvate on human colorectal cancer cells is dependent on glucose concentration but not hexokinase II expression.
26607110 2016 miR-4458 suppresses glycolysis and lactate production by directly targeting hexokinase2 in colon cancer cells.
26346032 2015 Human coronary thrombus formation is associated with degree of plaque disruption and expression of tissue factor and hexokinase II.
26323688 2015 Degradation of HK2 by chaperone-mediated autophagy promotes metabolic catastrophe and cell death.
26247723 2015 Hexokinase 2 controls cellular stress response through localization of an RNA-binding protein.
26134042 2015 Antitumor effects of a drug combination targeting glycolysis, glutaminolysis and de novo synthesis of fatty acids.
More...