Property Summary

NCBI Gene PubMed Count 56
PubMed Score 51.55
PubTator Score 82.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.300 1.8e-02
Breast cancer -1.400 7.2e-09
ependymoma 2.000 9.5e-04
Gaucher disease type 1 -1.600 1.4e-02
interstitial lung disease 1.100 2.7e-02
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous carcinoma... 1.600 7.7e-04
oligodendroglioma 1.700 9.4e-04
osteosarcoma -1.248 1.9e-04
ovarian cancer -1.800 1.3e-08
Pick disease -2.000 3.8e-07
progressive supranuclear palsy -1.700 1.1e-02
psoriasis -3.800 3.9e-05

Protein-protein Interaction (7)

Gene RIF (34)

AA Sequence

MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSPERERERRNSD      1 - 70
RSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSR     71 - 140
GFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFD    141 - 210
SEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQ    211 - 280
LSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQS    281 - 350
GEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS    351 - 420
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNS    421 - 490
LTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKN    491 - 560
SFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYSGDSDNEEEL    561 - 630
VERLESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMK    631 - 700
YRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGIT    701 - 770
APIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME                             771 - 815
//

Text Mined References (68)

PMID Year Title