Property Summary

NCBI Gene PubMed Count 50
Grant Count 2
Funding $105,796.75
PubMed Score 47.55
PubTator Score 82.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease 1.100 0.027
astrocytic glioma 2.200 0.013
ependymoma 2.500 0.016
oligodendroglioma 2.400 0.012
psoriasis -3.800 0.000
osteosarcoma -1.248 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
intraductal papillary-mucinous carcinoma... 1.600 0.001
Pick disease -2.000 0.000
progressive supranuclear palsy -1.700 0.011
ovarian cancer -1.800 0.000
Breast cancer -1.400 0.000
Gaucher disease type 1 -1.600 0.014

Synonym

Accession P52756 B2RA45 B4DM16 B4DMF9 B4DZ63 Q93021 Q9BU14 Q9HDA6 Q9UKY8 Q9UL24
Symbols G15
H37
RMB5
LUCA15

Gene

 Grant Application (2)

PDB

2LK0   2LK1   2LKZ  

Gene RIF (28)

PMID Text
25738917 ICG-001 had no apparent effect on the RBM5 levels.
25586139 RBM5 knockdown in human neuronal cells decreases caspase activation by staurosporine.
24332178 Antagonizes the effects of RBM5, RBM6, and RBM10 in cell colony formation.
23721095 Loss of RBM5 expression is associated with lung adenocarcinoma.
23158838 expression of RBM5 protein was significantly decreased in cancerous prostatic tissues compared to the normal tissues
23017209 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
22882865 The results suggest that RBM5 expression is not directly regulated by EGFR in non-smoker related lung adenocarinomas.
22866867 RBM5 can inhibit the growth of lung cancer cells and induce apoptosis both in vitro and in vivo.
22839758 NMR data analysis of RBM5 RRM2 reveals several features of protein-RNA interfaces. The most striking observation is the presence of two preferred target RNA sequences, the sequences [5'-(CUCUUC)-3'] and [5'-(GAGAAG)-3'].
22609235 RBM5 may serve as a biomarker with the ability to predict a response to cisplatin
More...

AA Sequence

MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSPERERERRNSD      1 - 70
RSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSR     71 - 140
GFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFD    141 - 210
SEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQ    211 - 280
LSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQS    281 - 350
GEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS    351 - 420
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNS    421 - 490
LTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKN    491 - 560
SFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYSGDSDNEEEL    561 - 630
VERLESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMK    631 - 700
YRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGIT    701 - 770
APIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME                             771 - 815
//

Text Mined References (62)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25738917 2015 RNA-binding motif protein 5 negatively regulates the activity of Wnt/?-catenin signaling in cigarette smoke-induced alveolar epithelial injury.
25586139 2015 The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice.
24332178 2013 RBM5, 6, and 10 differentially regulate NUMB alternative splicing to control cancer cell proliferation.
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23935508 2013 RBM5 is a male germ cell splicing factor and is required for spermatid differentiation and male fertility.
23721095 2013 Tumor suppressor gene RBM5 delivered by attenuated Salmonella inhibits lung adenocarcinoma through diverse apoptotic signaling pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...