Property Summary

NCBI Gene PubMed Count 26
Grant Count 11
R01 Count 6
Funding $826,424.51
PubMed Score 293.81
PubTator Score 58.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.500 0.000
lung cancer 1.100 0.009
diabetes mellitus -1.200 0.001
ovarian cancer 1.200 0.003

Gene RIF (17)

PMID Text
25645053 ZNF143 is directly recruited to the promoter of genes engage in chromatin interactions, where it binds to its DNA recognition sequence.
25437553 THAP11, ZNF143, and HCF-1 form a mutually dependent complex on chromatin, which is independent of E2F occupancy.
24952353 ZNF143 expresses different 3'-untranslated regions (3'-UTR) as a result of alternative polyadenylation
24009065 High zinc-finger protein 143 is associated with cancer cell migration and invasion through ZEB1 and E-cadherin in colon cancer.
23539139 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23152058 ZNF143 upregulated GPX1 activity and protecting cells from oxidative damage.
21909943 GIPC is involved in IGF-1 signaling leading to ZNF143 expression through the regulation of ROS production, which may play a role for colon cancer tumorigenesis.
21177654 The data provides the demonstration that hStaf/ZNF143 is indeed a transcription factor controlling the expression of divergent protein-protein and protein-non-coding RNA gene pairs.
20860770 ZNF143 might be a master regulator of the cell cycle.
20733350 data suggest that IGF-1 induces ZNF143 expression in cancer cells via PI3-kinase and reactive oxygen species generation during receptor internalization.
More...

AA Sequence

MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGSTAYIQHNSKDA      1 - 70
KLIDGQVIQLEDGSAAYVQHVPIPKSTGDSLRLEDGQAVQLEDGTTAFIHHTSKDSYDQSALQAVQLEDG     71 - 140
TTAYIHHAVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQ    141 - 210
EKKMQIVLQGHATRVTAKSQQSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFAT    211 - 280
GYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRT    281 - 350
HTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCN    351 - 420
HCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVT    421 - 490
QSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEG    491 - 560
EQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQ    561 - 630
GETPGLDD                                                                  631 - 638
//

Text Mined References (30)

PMID Year Title
25645053 2015 ZNF143 provides sequence specificity to secure chromatin interactions at gene promoters.
25437553 2014 Host cell factor-1 recruitment to E2F-bound and cell-cycle-control genes is mediated by THAP11 and ZNF143.
24952353 2014 ZNF143 is regulated through alternative 3'UTR isoforms.
24009065 2014 A role of zinc-finger protein 143 for cancer cell migration and invasion through ZEB1 and E-cadherin in colon cancer cells.
23539139 2013 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152058 2012 ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21909943 2011 GAIP-interacting protein, C-terminus is involved in the induction of zinc-finger protein 143 in response to insulin-like growth factor-1 in colon cancer cells.
21177654 2011 Genome-wide evidence for an essential role of the human Staf/ZNF143 transcription factor in bidirectional transcription.
More...