Property Summary

NCBI Gene PubMed Count 30
PubMed Score 308.23
PubTator Score 58.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.7e-06
psoriasis 6694 1.7e-04
diabetes mellitus 1728 1.5e-03
lung cancer 4740 9.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.200 1.5e-03
lung cancer 1.100 9.0e-03
ovarian cancer -1.100 6.7e-06
psoriasis 1.500 1.7e-04

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGSTAYIQHNSKDA      1 - 70
KLIDGQVIQLEDGSAAYVQHVPIPKSTGDSLRLEDGQAVQLEDGTTAFIHHTSKDSYDQSALQAVQLEDG     71 - 140
TTAYIHHAVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQ    141 - 210
EKKMQIVLQGHATRVTAKSQQSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFAT    211 - 280
GYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRT    281 - 350
HTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCN    351 - 420
HCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVT    421 - 490
QSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEG    491 - 560
EQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQ    561 - 630
GETPGLDD                                                                  631 - 638
//

Text Mined References (35)

PMID Year Title