Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.03
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.600 1.4e-04
spina bifida -1.381 3.4e-02

Gene RIF (1)

AA Sequence

MKRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDECKGHQGGFNGL      1 - 70
NQCLKITTSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECDKSLCMLSRLTQHKKIHTRENFYKC     71 - 140
EECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLT    141 - 210
RHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYKCEECGKAFNLS                      211 - 262
//

Text Mined References (9)

PMID Year Title