Property Summary

NCBI Gene PubMed Count 9
PubMed Score 114.07
PubTator Score 1064.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.4e-72
group 3 medulloblastoma 4104 1.9e-04
atypical teratoid / rhabdoid tumor 5112 3.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Causalgia 2 3.437 1.7
Cancer 2499 3.216 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.0e-04
group 3 medulloblastoma 1.700 1.9e-04
psoriasis -1.700 1.4e-72

AA Sequence

MTPGVRVSTDPEQVTFEDVVVGFSQEEWGQLKPAQRTLYRDVMLDTFRLLVSVGHWLPKPNVISLLEQEA      1 - 70
ELWAVESRLPQGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDGLWYCRGEDTEGHWEWSCESL     71 - 140
ESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVK    141 - 210
EKPYKCQECGKAFSHSSALIEHHRTHTGERPYECHECLKGFRNSSALTKHQRIHTGEKPYKCTQCGRTFN    211 - 280
QIAPLIQHQRTHTGEKPYECSECGKSFSFRSSFSQHERTHTGEKPYECSECGKAFRQSIHLTQHLRIHTG    281 - 350
EKPYQCGECGKAFSHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECGECGKAFS    351 - 420
QSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTG    421 - 490
EKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQHQRIHTGEKPYECNQCGRAFS    491 - 560
QSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTHTGEKPYECHDCGKSFRQSTHLTQHRRIHTG    561 - 630
EKPYACRDCGKAFTHSSSLTKHQRTHTG                                              631 - 658
//

Text Mined References (11)

PMID Year Title