Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.2e-07
Breast cancer -1.300 5.4e-04
glioblastoma 1.100 4.7e-08
group 4 medulloblastoma 1.600 6.6e-03
lung cancer 1.700 1.6e-04
medulloblastoma, large-cell -1.400 3.1e-05
osteosarcoma 1.446 2.7e-04

Gene RIF (1)

AA Sequence

MTLVTAGGAWTGPGCWHEVKDEESSSEQSISIAVSHVNTSKAGLPAQTALPCDICGPILKDILHLDEHQG      1 - 70
THHGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKN     71 - 140
FQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQHQRIHSGEKPYECSECG    141 - 210
KAFSRKATLVQHQRIHTGERPYECSECGKTFSRKDNLTQHKRIHTGEMPYKCNECGKYFSHHSNLIVHQR    211 - 280
VHNGARPYKCSDCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQRIHTESKPFECIECG    281 - 350
KFFSRSSDYIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYECSECGKAYSLSSHLNRHQK    351 - 420
VHTAGRL                                                                   421 - 427
//

Text Mined References (8)

PMID Year Title