Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.40832429955708E-5
medulloblastoma, large-cell 6234 3.11960803016155E-5
lung cancer 4473 1.63444490040115E-4
osteosarcoma 7933 2.66844840142383E-4
Breast cancer 3099 5.42501693197691E-4
glioblastoma 5572 6.07679436445244E-4
group 4 medulloblastoma 1875 0.00661492534016211

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.446 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.400 0.001
group 4 medulloblastoma 1.600 0.007
medulloblastoma, large-cell -1.400 0.000
lung cancer 1.700 0.000
Breast cancer -1.300 0.001

Synonym

Accession P52741 Q9Y4B2
Symbols pHZ-15

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
25144775 HIV-1 LTR mediated transcription and viral titers are increased by ZNF134

AA Sequence

MTLVTAGGAWTGPGCWHEVKDEESSSEQSISIAVSHVNTSKAGLPAQTALPCDICGPILKDILHLDEHQG      1 - 70
THHGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKN     71 - 140
FQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQHQRIHSGEKPYECSECG    141 - 210
KAFSRKATLVQHQRIHTGERPYECSECGKTFSRKDNLTQHKRIHTGEMPYKCNECGKYFSHHSNLIVHQR    211 - 280
VHNGARPYKCSDCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQRIHTESKPFECIECG    281 - 350
KFFSRSSDYIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYECSECGKAYSLSSHLNRHQK    351 - 420
VHTAGRL                                                                   421 - 427
//

Text Mined References (7)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.