Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.73
PubTator Score 2.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -2.400 1.2e-03
group 4 medulloblastoma 1.100 1.0e-03
lung cancer -1.900 9.2e-04
malignant mesothelioma -2.700 7.3e-08
osteosarcoma -2.444 1.2e-07
posterior fossa group B ependymoma 1.100 8.9e-07
psoriasis -1.600 4.4e-04

Gene RIF (3)

AA Sequence

MALPSPQVLMGLPALLMGPAQHTSWPCGSAVPTLKSMVTFEDVAVYFSQEEWELLDAAQRHLYHSVMLEN      1 - 70
LELVTSLGSWHGVEGEGAHPKQNVSVEVLQVRIPNADPSTKKANSCDMCGPFLKDILHLAEHQGTQSEEK     71 - 140
PYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKVILGSCDLLQL    141 - 210
QAVDSGQKPYSNLGQLPEVCTTQKLFECSNCGKAFLKSSTLPNHLRTHSEEIPFTCPTGGNFLEEKSILG    211 - 280
NKKFHTGEIPHVCKECGKAFSHSSKLRKHQKFHTEVKYYECIACGKTFNHKLTFVHHQRIHSGERPYECD    281 - 350
ECGKAFSNRSHLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQ    351 - 420
HWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGERPFECC    421 - 490
DCGKAFSNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGEKPYECSECGKAFAHSSTLIE    491 - 560
HWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYKCSECGKFFSRKSSLICHWRVHTGERPYECS    561 - 630
ECGRAFSSNSHLVRHQRVHTQERPYECIQCGKAFSERSTLVRHQKVHTRERTYECSQCGKLFSHLCNLAQ    631 - 700
HKKIHT                                                                    701 - 706
//

Text Mined References (9)

PMID Year Title