Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.80
PubTator Score 5.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer -1.200 0.014
malignant mesothelioma 1.200 0.000
astrocytic glioma 1.600 0.020
ependymoma 2.000 0.012
oligodendroglioma 2.000 0.006
osteosarcoma 2.270 0.000
intraductal papillary-mucinous adenoma (... 1.500 0.006
intraductal papillary-mucinous carcinoma... 1.800 0.009
diabetes mellitus -1.200 0.001
pancreatic carcinoma -1.200 0.014
Pick disease 1.100 0.000
ovarian cancer 1.500 0.001
pituitary cancer -1.200 0.003

Gene RIF (6)

PMID Text
26841866 identify a novel substoichiometric interactor of the complex, transcription factor ZNF131, which recruits EMSY to a large number of active, H3K4me3 marked promoters.
23404503 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131
23159625 these data suggest that ZNF131 inhibits estrogen signaling by acting as an ERalpha-co-repressor.
22467880 SUMOylation is a novel regulator of ZNF131 action in estrogen signaling and breast cancer cell proliferation.
18847501 Interaction between ZNF131 and ERalpha interrupts or prevents ERalpha binding to the estrogen response element. ZNF131 also suppresses the expression of TFF1.
17306895 The mechanism of Znf131 nuclear localization, is reported.

AA Sequence

MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQEFTQEP      1 - 70
LVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKN     71 - 140
EAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSA    141 - 210
LALLADITSKYRQGDRKGQIKEDGCPSDPTSKQVEGIEIVELQLSHVKDLFHCEKCNRSFKLFYHFKEHM    211 - 280
KSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKH    281 - 350
TGEKPFECPNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPN    351 - 420
HCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDS    421 - 490
AQVTVEQVHPDLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELL    491 - 560
EADLDHVTPEIMNQEERESSQADAAEAAREDHEDAEDLETKPTVDSEAEKAENEDRTALPVLE           561 - 623
//

Text Mined References (15)

PMID Year Title
26841866 2016 Recruitment of the Mammalian Histone-modifying EMSY Complex to Target Genes Is Regulated by ZNF131.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23404503 2013 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159625 2013 Zinc finger protein 131 inhibits estrogen signaling by suppressing estrogen receptor ? homo-dimerization.
22467880 2012 Small ubiquitin-like modifier (SUMO) modification of zinc finger protein 131 potentiates its negative effect on estrogen signaling.
18847501 2008 High-throughput cell-based screening reveals a role for ZNF131 as a repressor of ERalpha signaling.
17306895 2007 Nuclear trafficking of the POZ-ZF protein Znf131.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...