Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.34
PubTator Score 5.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.600 2.0e-02
diabetes mellitus -1.200 1.0e-03
ependymoma 2.000 1.2e-02
intraductal papillary-mucinous adenoma (... 1.500 5.8e-03
intraductal papillary-mucinous carcinoma... 1.800 8.9e-03
malignant mesothelioma 1.200 8.9e-06
oligodendroglioma 2.000 6.0e-03
osteosarcoma 1.842 1.1e-05
ovarian cancer -1.200 2.0e-09
pancreatic cancer -1.200 1.4e-02
pancreatic carcinoma -1.200 1.4e-02
Pick disease 1.100 1.4e-05
pituitary cancer -1.200 3.4e-03

Gene RIF (6)

AA Sequence

MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQEFTQEP      1 - 70
LVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKN     71 - 140
EAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSA    141 - 210
LALLADITSKYRQGDRKGQIKEDGCPSDPTSKQVEGIEIVELQLSHVKDLFHCEKCNRSFKLFYHFKEHM    211 - 280
KSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKH    281 - 350
TGEKPFECPNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPN    351 - 420
HCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDS    421 - 490
AQVTVEQVHPDLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELL    491 - 560
EADLDHVTPEIMNQEERESSQADAAEAAREDHEDAEDLETKPTVDSEAEKAENEDRTALPVLE           561 - 623
//

Text Mined References (16)

PMID Year Title