Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.97
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.200 3.0e-03
group 3 medulloblastoma 1.400 2.2e-03
hepatocellular carcinoma 1.400 9.7e-06
ovarian cancer -1.200 1.8e-05
pancreatic cancer 1.100 4.8e-03
pancreatic carcinoma 1.100 4.8e-03
psoriasis -2.000 5.4e-04
tuberculosis -1.600 2.9e-05

AA Sequence

MSQGSVTFRDVAIDFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSISKPDVVSLLEQGKEPWLGKRE      1 - 70
VKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSSFKGGWKCKDHTEMLQENQGCIRKV     71 - 140
TVSHQEALAQHMNISTVERPYGCHECGKTFGRRFSLVLHQRTHTGEKPYACKECGKTFSQISNLVKHQMI    141 - 210
HTGKKPHECKDCNKTFSYLSFLIEHQRTHTGEKPYECTECGKAFSRASNLTRHQRIHIGKKQYICRKCGK    211 - 280
AFSSGSELIRHQITHTGEKPYECIECGKAFRRFSHLTRHQSIHTTKTPYECNECRKAFRCHSFLIKHQRI    281 - 350
HAGEKLYECDECGKVFTWHASLIQHTKSHTGEKPYACAECDKAFSRSFSLILHQRTHTGEKPYVCKVCNK    351 - 420
SFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEHQ                                     421 - 457
//

Text Mined References (8)

PMID Year Title