Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.97
PubTator Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.200 0.003
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.100 0.005
psoriasis -2.000 0.001
medulloblastoma 1.400 0.000
tuberculosis and treatment for 6 months -2.000 0.000
pancreatic carcinoma 1.100 0.005
ovarian cancer -1.200 0.000

AA Sequence

MSQGSVTFRDVAIDFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSISKPDVVSLLEQGKEPWLGKRE      1 - 70
VKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSSFKGGWKCKDHTEMLQENQGCIRKV     71 - 140
TVSHQEALAQHMNISTVERPYGCHECGKTFGRRFSLVLHQRTHTGEKPYACKECGKTFSQISNLVKHQMI    141 - 210
HTGKKPHECKDCNKTFSYLSFLIEHQRTHTGEKPYECTECGKAFSRASNLTRHQRIHIGKKQYICRKCGK    211 - 280
AFSSGSELIRHQITHTGEKPYECIECGKAFRRFSHLTRHQSIHTTKTPYECNECRKAFRCHSFLIKHQRI    281 - 350
HAGEKLYECDECGKVFTWHASLIQHTKSHTGEKPYACAECDKAFSRSFSLILHQRTHTGEKPYVCKVCNK    351 - 420
SFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEHQ                                     421 - 457
//

Text Mined References (6)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7649249 1995 Repression of transcriptional activity by heterologous KRAB domains present in zinc finger proteins.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.