Property Summary

NCBI Gene PubMed Count 62
Grant Count 111
R01 Count 99
Funding $4,936,119.04
PubMed Score 58.33
PubTator Score 45.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.511 0.000
primitive neuroectodermal tumor 1.100 0.008
intraductal papillary-mucinous adenoma (... -1.500 0.002
colon cancer 1.100 0.010
breast carcinoma 1.200 0.001
gastric carcinoma 1.400 0.010
ovarian cancer 1.600 0.000
pituitary cancer -1.300 0.000

Gene

PDB

2LNW   2DLZ   2DM1   2LNX   4ROJ  

Gene RIF (51)

PMID Text
26919541 The crystal structure of the complex between a phosphorylated PPxY motif of TXNIP and the SH2 domain of Vav2 reveals a conserved recognition mechanism.
26224100 Our data provide the first evidence to implicate VAV2 in glucose-induced Rac1 activation, actin remodelling and glucose-stimulated insulin secretion in pancreatic beta cells.
24858039 Authors propose a model whereby vimentin promotes FAK stabilization through VAV2-mediated Rac1 activation. This model may explain why vimentin expressing metastatic lung cancer cells are more motile and invasive.
24835487 VAV2 is required for Met signaling in the perinuclear endosome.
23986795 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
23847689 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
23724134 the guanine nucleotide exchange factor (GEF) Vav2 is identified as a candidate partner for KCC3.
23615439 Data suggest a coordination between paxillin kinase linker (PKL)/Vav2 signaling and PKL/beta-PIX signaling during cell migration.
23402756 Two variants of VAV2 and VAV3, rs2156323 and rs2801219, respectively, were identified in Japanese patients with primary open angle glaucoma, normal tension glaucoma, and developmental glaucoma.
23033540 Data indicate that Vav2 and Vav3 controlled a vast transcriptional program in breast cancer cells through mechanisms that were shared between the two proteins, isoform-specific or synergistic.
More...

AA Sequence

MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFL      1 - 70
CLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDD     71 - 140
VYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETE    141 - 210
AKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERL    211 - 280
LIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHS    281 - 350
AERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH    351 - 420
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGF    421 - 490
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVG    491 - 560
AHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWE    561 - 630
GRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRER    631 - 700
PAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSR    701 - 770
ERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG    771 - 840
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ                                    841 - 878
//

Text Mined References (74)

PMID Year Title
26919541 2016 Structural basis for a novel interaction between TXNIP and Vav2.
26224100 2015 VAV2, a guanine nucleotide exchange factor for Rac1, regulates glucose-stimulated insulin secretion in pancreatic beta cells.
24858039 2015 Vimentin regulates lung cancer cell adhesion through a VAV2-Rac1 pathway to control focal adhesion kinase activity.
24835487 2014 Receptor tyrosine kinase c-Met controls the cytoskeleton from different endosomes via different pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23724134 2013 Potassium-chloride cotransporter 3 interacts with Vav2 to synchronize the cell volume decrease response with cell protrusion dynamics.
23615439 2013 Paxillin kinase linker (PKL) regulates Vav2 signaling during cell spreading and migration.
23402756 2013 Molecular genetic analysis of primary open-angle glaucoma, normal tension glaucoma, and developmental glaucoma for the VAV2 and VAV3 gene variants in Japanese subjects.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
More...