Property Summary

NCBI Gene PubMed Count 69
PubMed Score 64.65
PubTator Score 45.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma 1.200 8.4e-04
colon cancer 1.100 1.0e-02
gastric carcinoma 1.400 1.0e-02
intraductal papillary-mucinous adenoma (... -1.500 2.3e-03
osteosarcoma 1.511 1.4e-05
ovarian cancer 1.600 4.2e-05
pituitary cancer -1.300 1.2e-04
primitive neuroectodermal tumor 1.100 7.6e-03

Protein-protein Interaction (5)

Gene RIF (55)

AA Sequence

MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFL      1 - 70
CLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDD     71 - 140
VYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETE    141 - 210
AKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERL    211 - 280
LIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHS    281 - 350
AERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH    351 - 420
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGF    421 - 490
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVG    491 - 560
AHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWE    561 - 630
GRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRER    631 - 700
PAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSR    701 - 770
ERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG    771 - 840
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ                                    841 - 878
//

Text Mined References (81)

PMID Year Title