Property Summary

NCBI Gene PubMed Count 111
Grant Count 124
R01 Count 84
Funding $29,519,338.48
PubMed Score 377.59
PubTator Score 261.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52732 A0AV49 B2RMV3 Q15716 Q5VWX0
Symbols EG5
HKSP
KNSL1
MCLMR
TRIP5

Gene

PDB

1II6   1Q0B   1X88   1YRS   2FKY   2FL2   2FL6   2FME   2G1Q   2GM1   2IEH   2PG2   2Q2Y   2Q2Z   2UYI   2UYM   2WOG   2X2R   2X7C   2X7D   2X7E   2XAE   3CJO   3HQD   3K3B   3K5E   3KEN   3L9H   3WPN   3ZCW   4A1Z   4A28   4A50   4A51   4A5Y   4AP0   4AQV   4AQW   4AS7   4B7B   4BBG   4BXN   4CK5   4CK6   4CK7   4ZCA   4ZHI   5JV3  

Gene RIF (91)

PMID Text
26658059 Data show there was no significant change in Eg5 protein inhibitor treatment.
26472404 Identification of mutations in 8.3% patients suggests KIF11 mutations as a common cause of familial exudative vitreoretinopathy (FEVR).
26456023 This stuidy demonstrated that overexpression of Eg5 associates with high-grade astrocytic neoplasm.
26355032 Targeting KIF11 also hit the other arm of the "go or grow" cell fate decision by reducing glioma cell invasion.
26304237 Data show that kinesin spindle protein Eg5 inhibitor LY2523355 has broad target-mediated anticancer activity in vitro and in vivo.
26257190 the levels and distribution of TPX2 are likely to be determinants of when and where kinesin-5 acts in neurons.
26018074 Dimeric, but not monomeric, Eg5 was differentially inhibited by full-length and truncated TPX2, demonstrating that dimerization or residues in the neck region are important for the interaction of TPX2 with Eg5.
25996076 Patients with KIF11 mutations show a specific ocular phenotype with variable expressivity and intrafamilial variability. Macular atrophy and dysfunction have not been consistently documented before.
25934493 All inherited cases, and 50% of sporadic cases of MCLMR are due to germline KIF11 mutations. It is possible that mosaic KIF11 mutations cause the remainder of sporadic case
25764055 This identified a heterozygous 2-base pair deletion (Thr65 del 2 base pair AT) in exon 2 that, to our knowledge, has not been previously reported.
More...

AA Sequence

MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDM      1 - 70
VFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTL     71 - 140
HQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEV    141 - 210
YQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDK    211 - 280
RAREAGNINQSLLTLGRVITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTL    281 - 350
EYAHRAKNILNKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV    351 - 420
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEYITSALESTEE    421 - 490
KLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNSLFNNMEELIKDGSSKQKAML    491 - 560
EVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHVSQIFNMILKEQSLAAESKTVLQELINVLKT    561 - 630
DLLSSLEMILSPTVVSILKINSQLKHIFKTSLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVES    631 - 700
QKQCGNLTEDLKTIKQTHSQELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQ    701 - 770
KFCADSDGFSQELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER    771 - 840
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNETIKIGLTKLN    841 - 910
CFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLMMLNCSENNKEETIPDVDVEE    911 - 980
AVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGKDKENRGINTLERSKVEETTEHLVTKSRLPL    981 - 1050
RAQINL                                                                   1051 - 1056
//

Text Mined References (118)

PMID Year Title
26658059 2015 A Potent Chemotherapeutic Strategy with Eg5 Inhibitor against Gemcitabine Resistant Bladder Cancer.
26472404 2016 KIF11 mutations are a common cause of autosomal dominant familial exudative vitreoretinopathy.
26456023 2016 Overexpression of Eg5 correlates with high grade astrocytic neoplasm.
26355032 2015 The mitotic kinesin KIF11 is a driver of invasion, proliferation, and self-renewal in glioblastoma.
26304237 2015 A Novel Eg5 Inhibitor (LY2523355) Causes Mitotic Arrest and Apoptosis in Cancer Cells and Shows Potent Antitumor Activity in Xenograft Tumor Models.
26257190 2015 TPX2 regulates neuronal morphology through kinesin-5 interaction.
26018074 2015 TPX2 Inhibits Eg5 by Interactions with Both Motor and Microtubule.
25996076 2016 Ocular manifestations of microcephaly with or without chorioretinopathy, lymphedema or intellectual disability (MCLID) syndrome associated with mutations in KIF11.
25934493 2015 No evidence of locus heterogeneity in familial microcephaly with or without chorioretinopathy, lymphedema, or mental retardation syndrome.
25764055 2015 Autosomal Dominant Microcephaly Associated With Congenital Lymphedema and Chorioretinopathy Due to a Novel Mutation in KIF11.
More...