Property Summary

NCBI Gene PubMed Count 291
PubMed Score 572.31
PubTator Score 545.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.7
Carcinoma 11493 0.0 1.3
DOID:2627 94 0.0 0.5
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.4
Disease Target Count Z-score Confidence
ovarian cancer 8520 0.0 0.0100752235565464
Disease Target Count Z-score Confidence
Cancer 2499 5.684 2.8
Familial adenomatous polyposis 32 4.492 2.2
Adenoma 167 4.064 2.0

Expression

  Differential Expression (22)

Disease log2 FC p
ovarian cancer 1.300 1.0e-02
lung cancer 1.100 2.5e-04
ependymoma 1.600 4.9e-07
glioblastoma 1.400 4.0e-04
lung adenocarcinoma 1.840 6.2e-08
atypical teratoid / rhabdoid tumor 2.100 1.2e-04
dermatomyositis 1.100 3.8e-04
Down syndrome 1.500 3.1e-04
group 3 medulloblastoma 1.800 4.4e-05
intraductal papillary-mucinous adenoma (... -1.300 3.5e-04
invasive ductal carcinoma -1.352 1.2e-03
juvenile dermatomyositis 1.014 1.6e-11
medulloblastoma, large-cell 1.100 3.3e-05
Multiple myeloma 1.507 2.3e-03
nasopharyngeal carcinoma 1.200 1.0e-05
non-small cell lung cancer 1.426 5.9e-21
osteosarcoma 1.217 2.8e-02
pediatric high grade glioma 1.600 2.8e-03
primitive neuroectodermal tumor 1.200 1.0e-03
psoriasis -2.200 1.1e-04
subependymal giant cell astrocytoma -1.232 4.0e-02
Waldenstrons macroglobulinemia 1.395 1.4e-02

 GWAS Trait (1)

Gene RIF (255)

AA Sequence

MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAK      1 - 70
NLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTR     71 - 140
GWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEV    141 - 210
GTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISS    211 - 280
GVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQA    281 - 350
HVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN    351 - 420
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPE    421 - 490
MMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLLSLKEKEEDSSGHTRAYGVCF    491 - 560
VDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDA    561 - 630
SKTLRTLLEEEYFREKLSDGIGVMLPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQEL    631 - 700
LSMANFEEYIPLDSDTVSTTRSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFG    701 - 770
KRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS    771 - 840
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEGRFPDLTVELN    841 - 910
RWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLE    911 - 980
IPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSA    981 - 1050
VECIAVLDVLLCLANYSRGGDGPMCRPVILLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEE   1051 - 1120
EQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTF   1121 - 1190
FVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV   1191 - 1260
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSL   1261 - 1330
RLFREVCLASERSTVDAEAVHKLLTLIKEL                                           1331 - 1360
//

Text Mined References (321)

PMID Year Title