Property Summary

NCBI Gene PubMed Count 29
Grant Count 2
R01 Count 2
Funding $405,360
PubMed Score 15.54
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.391 0.001
oligodendroglioma -1.100 0.016
ovarian cancer -1.100 0.000

Synonym

Accession P52657 A8MYQ7 Q6FGB5
Symbols TF2A2
TFIIA
T18745
TFIIAS
HsT18745
TFIIA-12
TFIIA-gamma

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1NVP   5FUR  

Gene RIF (6)

PMID Text
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
21489275 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
14570910 transcription factor IIA may regulate the intracellular molecular state and the function of TATA-binding protein-like protein (TLP) through its property of binding to TLP
8849451 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764062 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro

AA Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN      1 - 70
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE                                    71 - 109
//

Text Mined References (32)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25416956 2014 A proteome-scale map of the human interactome network.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14570910 2004 Specific interaction with transcription factor IIA and localization of the mammalian TATA-binding protein-like protein (TLP/TRF2/TLF).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107178 2002 The germ cell-specific transcription factor ALF. Structural properties and stabilization of the TATA-binding protein (TBP)-DNA complex.
11564872 2001 Positive and negative TAF(II) functions that suggest a dynamic TFIID structure and elicit synergy with traps in activator-induced transcription.
More...