Property Summary

NCBI Gene PubMed Count 29
PubMed Score 15.54
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 5.0e-06
Multiple myeloma 1327 5.4e-04
oligodendroglioma 2849 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.391 5.4e-04
oligodendroglioma -1.100 1.6e-02
ovarian cancer -1.100 5.0e-06

Synonym

Accession P52657 A8MYQ7 Q6FGB5
Symbols TF2A2
TFIIA
T18745
TFIIAS
HsT18745
TFIIA-12
TFIIA-gamma

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1NVP   5FUR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
21489275 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
14570910 transcription factor IIA may regulate the intracellular molecular state and the function of TATA-binding protein-like protein (TLP) through its property of binding to TLP
8849451 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764062 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro

AA Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN      1 - 70
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE                                    71 - 109
//

Text Mined References (32)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25416956 2014 A proteome-scale map of the human interactome network.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14570910 2004 Specific interaction with transcription factor IIA and localization of the mammalian TATA-binding protein-like protein (TLP/TRF2/TLF).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107178 2002 The germ cell-specific transcription factor ALF. Structural properties and stabilization of the TATA-binding protein (TBP)-DNA complex.
11564872 2001 Positive and negative TAF(II) functions that suggest a dynamic TFIID structure and elicit synergy with traps in activator-induced transcription.
11509574 2001 Structural and functional interactions of transcription factor (TF) IIA with TFIIE and TFIIF in transcription initiation by RNA polymerase II.
11340159 2001 p53 Stimulates TFIID-TFIIA-promoter complex assembly, and p53-T antigen complex inhibits TATA binding protein-TATA interaction.
11030333 2000 TAC, a TBP-sans-TAFs complex containing the unprocessed TFIIAalphabeta precursor and the TFIIAgamma subunit.
11005381 2000 Potential targets for HSF1 within the preinitiation complex.
10570139 1999 Human TATA-binding protein-related factor-2 (hTRF2) stably associates with hTFIIA in HeLa cells.
10567404 1999 A nuclear factor, ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.
10364255 1999 Identification of a general transcription factor TFIIAalpha/beta homolog selectively expressed in testis.
9632777 1998 Simian virus 40 large T antigen stabilizes the TATA-binding protein-TFIIA complex on the TATA element.
9603936 1998 Transcription factor IIA derepresses TATA-binding protein (TBP)-associated factor inhibition of TBP-DNA binding.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
8946909 1996 The general transcription factors of RNA polymerase II.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8764062 1996 Interaction of human immunodeficiency virus type 1 Tat with a unique site of TFIID inhibits negative cofactor Dr1 and stabilizes the TFIID-TFIIA complex.
8626665 1996 Transcription factor IIA mutations show activator-specific defects and reveal a IIA function distinct from stimulation of TBP-DNA binding.
8577725 1996 Protein-protein interactions in eukaryotic transcription initiation: structure of the preinitiation complex.
8224850 1993 Isolation of a cDNA encoding the largest subunit of TFIIA reveals functions important for activated transcription.
8224848 1993 A single cDNA, hTFIIA/alpha, encodes both the p35 and p19 subunits of human TFIIA.
7958900 1994 Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription.
7958899 1994 Molecular cloning of the small (gamma) subunit of human TFIIA reveals functions critical for activated transcription.
7724559 1995 Human general transcription factor TFIIA: characterization of a cDNA encoding the small subunit and requirement for basal and activated transcription.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.