Property Summary

NCBI Gene PubMed Count 30
PubMed Score 16.54
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.0e-06
Multiple myeloma 1332 5.4e-04
oligodendroglioma 2850 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.391 5.4e-04
oligodendroglioma -1.100 1.6e-02
ovarian cancer -1.100 5.0e-06

Synonym

Accession P52657 A8MYQ7 Q6FGB5
Symbols TF2A2
TFIIA
T18745
TFIIAS
HsT18745
TFIIA-12
TFIIA-gamma

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1NVP   5FUR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN      1 - 70
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE                                    71 - 109
//

Text Mined References (33)

PMID Year Title