Property Summary

Ligand Count 3
NCBI Gene PubMed Count 48
PubMed Score 1.06
PubTator Score 76.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.700 2.7e-02
acute quadriplegic myopathy 1.115 6.3e-05
ovarian cancer -1.200 7.6e-03
primary pancreatic ductal adenocarcinoma 1.033 4.4e-03
psoriasis -1.400 2.0e-03

Protein-protein Interaction (7)

Gene RIF (19)

AA Sequence

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV      1 - 70
QQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATA     71 - 140
ATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLP    141 - 210
GGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTS    211 - 280
SEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK    281 - 350
FHLKDGIMNLNGRDYIFSKAIGDAEW                                                351 - 376
//

Text Mined References (54)

PMID Year Title