Property Summary

NCBI Gene PubMed Count 45
Grant Count 111
R01 Count 86
Funding $10,186,227.76
PubMed Score 0.73
PubTator Score 76.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.400 0.002
acute quadriplegic myopathy 1.115 0.000
primary pancreatic ductal adenocarcinoma 1.033 0.004
acute myeloid leukemia -1.700 0.027
ovarian cancer 1.600 0.012

Synonym

Accession P52655 Q3KNQ9
Symbols TF2A1
TFIIA
TFIIAL
TFIIA-42

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1NVP   5FUR  

Gene RIF (16)

PMID Text
25996597 Our results provide first evidence that Taspase1 processing affects TFIIA regulation of TFIID and suggest that Taspase1 processing of TFIIA is required to establish INR-selective core promoter activity in the presence of NC2.
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
21489275 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
19724865 GTF2A1 alone, or GTF2A1 plus HAAO are excellent candidate biomarkers for detecting Ovarian cancer
18976975 Knockdown of general transcription factor IIA, 1, 19/37kDa (GTF2A1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18950845 Observational study of gene-disease association. (HuGE Navigator)
17681538 TFIIA induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.
17596959 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16537915 Transfected taspase 1 enhances cleavage of TFIIA, and RNA interference knockdown of endogenous taspase 1 diminishes cleavage of TFIIA in vivo.
More...

AA Sequence

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV      1 - 70
QQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATA     71 - 140
ATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLP    141 - 210
GGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTS    211 - 280
SEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK    281 - 350
FHLKDGIMNLNGRDYIFSKAIGDAEW                                                351 - 376
//

Text Mined References (51)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25996597 2015 Taspase1 processing alters TFIIA cofactor properties in the regulation of TFIID.
25416956 2014 A proteome-scale map of the human interactome network.
24835508 2014 Activity of the upstream TATA-less promoter of the p21(Waf1/Cip1) gene depends on transcription factor IIA (TFIIA) in addition to TFIIA-reactive TBP-like protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19724865 2009 Identification of candidate epigenetic biomarkers for ovarian cancer detection.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
More...