Property Summary

NCBI Gene PubMed Count 121
Grant Count 219
R01 Count 148
Funding $17,773,509.74
PubMed Score 227.72
PubTator Score 197.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.300 0.000
malignant mesothelioma -1.200 0.000
cutaneous lupus erythematosus 1.400 0.018
osteosarcoma 2.188 0.000
medulloblastoma, large-cell -1.300 0.002
juvenile dermatomyositis 2.307 0.000
primary pancreatic ductal adenocarcinoma 1.515 0.002
tuberculosis 1.200 0.001
group 4 medulloblastoma 1.600 0.001
Pick disease -1.100 0.000
ovarian cancer 1.800 0.000
pancreatic cancer 1.300 0.004

Synonym

Accession P52630 B4DLC7 G3V2M6 Q16430 Q16431 Q9UDL4
Symbols P113
IMD44
ISGF-3
STAT113

Gene

PANTHER Protein Class (1)

PDB

2KA4  

Gene RIF (81)

PMID Text
26945968 These results suggest that STAT6 plays an important role in regulating Sp1 and BCL6 through STAT2 to exert the anti-proliferative effects of type I IFN.
26897526 These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction.
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26335850 transcriptional activation of Adar1 by IFN occurs in the absence of STAT1 by a non-canonical STAT2-dependent pathway in mouse but not human cells.
25965795 The results demonstrated that Peste-des-petits-ruminants virus V protein blocks interferon actions in a dose dependent manner and restrains the translocation of STAT1/2 proteins.
25921106 STAT2 rs2066807 polymorphism is not associated with cervical cancer.
25773664 IFN-beta exhibited significant cytotoxicity in HepG2 cells mainly through phosphorylation of STAT2.
25529283 TRAF2 and TRAF6 proteins are required for the HIV-1 Nef-induced tyrosine phosphorylation of STAT1 and STAT2 proteins. Both myristoylation and acidic cluster of Nef are essential to induce the tyrosine phosphorylation
25293394 Influenza virus-infected cells respond with increased induction of interferon beta upon Staphylococcus aureus super-infection, however, subsequent interferon-stimulated gene expression are rather impaired due to a block of STAT1-STAT2 dimerization.
25008924 TRAF2 and TRAF6 proteins are required for the HIV-1 Nef-induced tyrosine phosphorylation of STAT1 and STAT2 proteins. Both myristoylation and acidic cluster of Nef are essential to induce the tyrosine phosphorylation
More...

AA Sequence

MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYE      1 - 70
CGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVES     71 - 140
QQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRR    141 - 210
KEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELK    211 - 280
GLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRL    281 - 350
QEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG    351 - 420
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPK    421 - 490
APWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKI    491 - 560
LELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQP    561 - 630
YTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSN    631 - 700
RQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMV    701 - 770
SQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF    771 - 840
YTDGPLMPSDF                                                               841 - 851
//

Text Mined References (127)

PMID Year Title
26945968 2016 The anti-proliferative effects of type I IFN involve STAT6-mediated regulation of SP1 and BCL6.
26897526 2016 Interferon-induced transmembrane protein 1 (IFITM1) overexpression enhances the aggressive phenotype of SUM149 inflammatory breast cancer cells in a signal transducer and activator of transcription 2 (STAT2)-dependent manner.
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26335850 2015 STAT2-dependent induction of RNA adenosine deaminase ADAR1 by type I interferon differs between mouse and human cells in the requirement for STAT1.
26122121 2015 Signal transducer and activator of transcription 2 deficiency is a novel disorder of mitochondrial fission.
25965795 2015 Identification of amino-acid residues in the V protein of peste des petits ruminants essential for interference and suppression of STAT-mediated interferon signaling.
25921106 2015 Association Study of Single-Nucleotide Polymorphisms of STAT2/STAT3/IFN-? Genes in Cervical Cancer in Southern Chinese Han Women.
25773664 2015 Inhibitory effects of interferon-? on hepatocellular carcinoma HepG2 via Akt/STAT phosphorylation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25293394 2015 Super-infection with Staphylococcus aureus inhibits influenza virus-induced type I IFN signalling through impaired STAT1-STAT2 dimerization.
More...