Property Summary

NCBI Gene PubMed Count 137
PubMed Score 248.77
PubTator Score 197.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.300 5.4e-05
cutaneous lupus erythematosus 1.400 1.8e-02
group 4 medulloblastoma 1.600 9.2e-04
juvenile dermatomyositis 2.307 1.2e-16
malignant mesothelioma -1.200 3.4e-05
medulloblastoma, large-cell -1.300 2.1e-03
osteosarcoma 1.596 1.0e-05
ovarian cancer -1.300 2.4e-06
pancreatic cancer 1.300 4.0e-03
Pick disease -1.100 1.3e-04
primary pancreatic ductal adenocarcinoma 1.515 2.3e-03
tuberculosis 1.200 7.1e-04

Gene RIF (95)

AA Sequence

MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYE      1 - 70
CGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVES     71 - 140
QQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRR    141 - 210
KEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELK    211 - 280
GLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRL    281 - 350
QEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG    351 - 420
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPK    421 - 490
APWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKI    491 - 560
LELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQP    561 - 630
YTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSN    631 - 700
RQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMV    701 - 770
SQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF    771 - 840
YTDGPLMPSDF                                                               841 - 851
//

Text Mined References (144)

PMID Year Title