Property Summary

NCBI Gene PubMed Count 47
PubMed Score 39.64
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.500 1.3e-10
group 3 medulloblastoma 1.500 3.1e-03
lung adenocarcinoma 1.042 1.1e-04
non primary Sjogren syndrome sicca 1.200 2.4e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (20)

AA Sequence

MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMA      1 - 70
LKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNG     71 - 140
ITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPY    141 - 210
DRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE    211 - 280
FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA    281 - 350
NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD         351 - 415
//

Text Mined References (63)

PMID Year Title