Property Summary

NCBI Gene PubMed Count 35
PubMed Score 476.32
PubTator Score 79.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid arthritis 1.100 4.7e-02
acute quadriplegic myopathy 1.071 3.4e-05
Breast cancer -1.300 2.3e-12
gastric cancer -1.400 3.8e-02
intraductal papillary-mucinous adenoma (... 1.800 1.3e-04
intraductal papillary-mucinous carcinoma... 1.600 8.7e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.2e-02
invasive ductal carcinoma -1.200 4.2e-03
medulloblastoma, large-cell -1.600 1.6e-03
osteosarcoma 2.792 1.5e-06
ovarian cancer -2.100 2.1e-09
psoriasis 1.800 5.5e-05
tuberculosis -1.100 5.9e-05

Gene RIF (24)

AA Sequence

MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISM      1 - 70
TTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVH     71 - 140
ASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAA    141 - 210
PAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNA    211 - 280
NFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFG    281 - 350
TTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPAS    351 - 420
SSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSF    421 - 490
QQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNP    491 - 560
FL                                                                        561 - 562
//

Text Mined References (46)

PMID Year Title