Property Summary

NCBI Gene PubMed Count 34
Grant Count 261
R01 Count 162
Funding $39,655,297.15
PubMed Score 445.33
PubTator Score 79.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52594 B3KUL1 E9PHX7 Q15277 Q4VAS0 Q4VAS1 Q4VAS3 Q53QT8 Q53R11
Symbols HRB
RAB
RIP

Gene

PDB

2D9L   2OLM   2VX8  

Gene RIF (27)

PMID Text
26701340 HRB knock-down affected CD4 downregulation induced by Nef but not by HIV-1 Vpu.
24577083 Selenite caused CYLD upregulation via LEF1 and cIAP downregulation, both of which contribute to the degradation of ubiquitin chains on RIP1 and subsequent caspase-8 activation and colorectal tumor cell apoptosis.
23984888 The top primary GWAS association of Airway hyperresponsiveness was in rs6731443 (P-value 2.5E-06) located within the AGFG1 genes.
21752912 The authors show that cells lacking functional HRB have significantly reduced production of influenza virus progeny and that this defect results from impaired viral ribonucleoprotein (vRNP) delivery to the plasma membrane.
21439320 Association ofalpha-synuclein with Rab attachment receptor protein and soluble sensitive factor attachment receptors (SNAREs) highlights a key role for membrane transport defects in alpha-synuclein-mediated pathology.
21360055 Depletion of endogenous HIV-1 Rev binding protein (hRIP) by RNA interference results in the loss of viral replication in human cell lines and primary macrophages; virus production is restored to wild-type levels after reintroduction of hRIP protein
21360055 Depletion of endogenous HIV-1 Rev binding protein (hRIP) by RNA interference results in the loss of viral replication in human cell lines and primary macrophages; virus production is restored to wild-type levels after reintroduction of hRIP protein
21358275 Depletion of endogenous HIV-1 Rev binding protein (hRIP) by RNA interference results in the loss of viral replication in human cell lines and primary macrophages; virus production is restored to wild-type levels after reintroduction of hRIP protein
21118098 Depletion of endogenous HIV-1 Rev binding protein (hRIP) by RNA interference results in the loss of viral replication in human cell lines and primary macrophages; virus production is restored to wild-type levels after reintroduction of hRIP protein
19262425 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISM      1 - 70
TTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVH     71 - 140
ASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAA    141 - 210
PAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNA    211 - 280
NFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFG    281 - 350
TTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPAS    351 - 420
SSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSF    421 - 490
QQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNP    491 - 560
FL                                                                        561 - 562
//

Text Mined References (45)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26701340 2016 The human immunodeficiency virus (HIV) Rev-binding protein (HRB) is a co-factor for HIV-1 Nef-mediated CD4 downregulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24577083 2014 The LEF1/CYLD axis and cIAPs regulate RIP1 deubiquitination and trigger apoptosis in selenite-treated colorectal cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23984888 2013 ITGB5 and AGFG1 variants are associated with severity of airway responsiveness.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
21752912 2011 Human immunodeficiency virus rev-binding protein is essential for influenza a virus replication and promotes genome trafficking in late-stage infection.
More...