Property Summary

NCBI Gene PubMed Count 20
PubMed Score 33.65
PubTator Score 96.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Duchenne muscular dystrophy 602 5.39540688528132E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 2.71016268395242E-7
lung cancer 4473 5.06021168706382E-6
group 4 medulloblastoma 1875 7.15365856496035E-6
pilocytic astrocytoma 3086 2.04619480433355E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.34850539751836E-5
chronic rhinosinusitis 512 1.04260480590046E-4
posterior fossa group B ependymoma 1530 2.25396884632444E-4
cystic fibrosis and chronic rhinosinusitis 213 0.00200461468743731
pancreatic cancer 2300 0.00246921498249775
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00299369162163491
pediatric high grade glioma 2712 0.00363022955772284
ovarian cancer 8492 0.00768032655825017
primitive neuroectodermal tumor 3031 0.00855903537204132
invasive ductal carcinoma 2950 0.0107763264511446
pituitary cancer 1972 0.015871756468078
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0182364423604149
atypical teratoid/rhabdoid tumor 1095 0.0271900886904896
glioblastoma 5572 0.0301335889948187
spina bifida 1064 0.0458977361311681
Disease Target Count Z-score Confidence
Lysinuric protein intolerance 15 4.762 2.4

Expression

Synonym

Accession P52569 B7ZL54 O15291 O15292 Q14CQ6 Q6NSZ7 Q86TC6 CAT-2
Symbols CAT2
ATRC2
HCAT2

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (10)

PMID Text
24019517 Identification of cysteine residues in human cationic amino acid transporter hCAT-2A that are targets for inhibition by N-ethylmaleimide.
22870827 CAT1, CAT2, and CAT3 localized in adult brains but with uneven distribution.
22787143 A chimera carrying the functional domain of the orphan protein SLC7A14 in the backbone of SLC7A2 mediates trans-stimulated arginine transport.
20600019 Addition of spermine or knockdown of CAT2 inhibited L-Arg uptake, NO production, and iNOS protein levels, whereas knockdown of ODC had the opposite effect. CAT2 and ODC were increased in mouse and human H pylori gastritis tissues.
20430034 Activation of PKCalpha by phorbol esters or thymeleatoxin causes a transient increase of arginine transport through system y(+), referable to the induction of SLC7A2 mRNAs and to the increased expression of CAT2 transporters.
20424473 Observational study of gene-disease association. (HuGE Navigator)
18172665 distribution of human cationic amino acid transporters 1 (hCAT1) and 2 (hCAT2) in healthy skin and compared it to psoriatic skin lesions by means of immunohistochemistry
15064952 Insulin increased L-arginine transport and the mRNA levels for hCAT-1 and hCAT-2B
12787129 Keratinocytes express cationic amino acid transporters 1 and 2. Cationic amino acid transporter mediated L-arginine essential for inducible nitric oxide synthase and arginase enzyme, which modulate proliferation and differentiation of epidermal cells.
11665818 analysis of the genomic organization

AA Sequence

MIPCRAALTFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVV      1 - 70
SFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDE     71 - 140
LLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNILVLLFVMVAGF    141 - 210
VKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEE    211 - 280
VRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALS    281 - 350
TSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLM    351 - 420
AYSLVAACVLILRYQPGLSYDQPKCSPEKDGLGSSPRVTSKSESQVTMLQRQGFSMRTLFCPSLLPTQQS    421 - 490
ASLVSFLVGFLAFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLFVAIVLTIWRQPQNQQKVAFMVPF    491 - 560
LPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAE    561 - 630
EKSAIQANDHHPRNLSSPFIFHEKTSEF                                              631 - 658
//

Text Mined References (26)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019517 2013 Identification of cysteine residues in human cationic amino acid transporter hCAT-2A that are targets for inhibition by N-ethylmaleimide.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22870827 2013 Differential topochemistry of three cationic amino acid transporter proteins, hCAT1, hCAT2 and hCAT3, in the adult human brain.
22787143 2012 A chimera carrying the functional domain of the orphan protein SLC7A14 in the backbone of SLC7A2 mediates trans-stimulated arginine transport.
20600019 2010 Polyamines Impair Immunity to Helicobacter pylori by Inhibiting L-Arginine Uptake Required for Nitric Oxide Production.
20430034 2010 Regulation of arginine transport and metabolism by protein kinase Calpha in endothelial cells: stimulation of CAT2 transporters and arginase activity.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...