Property Summary

NCBI Gene PubMed Count 69
PubMed Score 95.03
PubTator Score 183.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.0449863570709E-22
non-small cell lung cancer 2798 2.75006874995354E-13
juvenile dermatomyositis 1189 6.33255106005138E-11
malignant mesothelioma 3163 5.24858302421623E-10
Duchenne muscular dystrophy 602 6.56833387933817E-10
pilocytic astrocytoma 3086 2.54205421088141E-7
posterior fossa group A ependymoma 1511 1.19104797702355E-6
ulcerative colitis 2087 5.04408725392382E-6
pediatric high grade glioma 2712 7.65342845194649E-6
lung cancer 4473 1.6114431747238E-5
ovarian cancer 8492 3.08718987101778E-5
psoriasis 6685 4.64453661524924E-5
cystic fibrosis 1670 5.63584131778976E-5
glioblastoma 5572 1.02424305351442E-4
Rheumatoid Arthritis 1171 2.32954855867133E-4
osteosarcoma 7933 0.00148796747523673
dermatomyositis 967 0.00210245678382357
invasive ductal carcinoma 2950 0.00294878271942127
pancreatic cancer 2300 0.00402378588972211
Breast cancer 3099 0.00899360031510071
subependymal giant cell astrocytoma 2287 0.0111840499287513
diabetes mellitus 1663 0.0133136149297511
Waldenstrons macroglobulinemia 765 0.0150636131203906
active Crohn's disease 918 0.017764724917992
astrocytoma 1493 0.0259082678879249
primary Sjogren syndrome 789 0.0377662693209966
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0448503523221011
Disease Target Count Z-score Confidence
Cancer 2346 3.701 1.9

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.000
Waldenstrons macroglobulinemia 1.513 0.015
malignant mesothelioma 5.900 0.000
glioblastoma 2.500 0.000
osteosarcoma -1.788 0.001
posterior fossa group A ependymoma 1.400 0.000
cystic fibrosis 1.098 0.000
astrocytoma 1.700 0.026
Duchenne muscular dystrophy 1.139 0.000
juvenile dermatomyositis 1.300 0.000
non-small cell lung cancer -1.148 0.000
intraductal papillary-mucinous carcinoma... -1.800 0.045
lung cancer -2.400 0.000
active Crohn's disease 1.384 0.018
ulcerative colitis 2.800 0.000
diabetes mellitus -1.200 0.013
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.900 0.000
primary Sjogren syndrome 1.400 0.038
subependymal giant cell astrocytoma 1.686 0.011
Breast cancer 1.100 0.009
invasive ductal carcinoma 1.116 0.003
psoriasis 1.100 0.000
lung carcinoma -2.000 0.000
ovarian cancer 2.400 0.000
pancreatic cancer 1.100 0.004
dermatomyositis 1.500 0.002

Synonym

Accession P52566 B5BU79 Rho GDI 2
Symbols D4
GDIA2
GDID4
LYGDI
Ly-GDI
RAP1GN1
RhoGDI2

Gene

PDB

1DS6  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (44)

PMID Text
26707877 Our interpretation of these contradictions is that truncation and/or mutation of RhoGDI2 perturbs its conformation to expose a site that adventitiously binds FLNA and is not a bona-fide interaction.
25562149 These findings indicate that RhoGDI2 repressed the activity of Rac1 and may be involved in the rearrangement of cytoskeleton in lung cancer cells.
25516960 Results show that RhoGDI2 suppresses bladder cancer metastatic colonization via negative regulation of RhoC activity, providing a rationale for the development of therapeutics that target RhoC signaling.
25266803 Short hairpin RNA-mediated knockdown of RhoGDI2 induces the invasion and migration of lung cancer due to cross-talk with the PI3K/Akt pathway and MMP-9.
24788627 Depletion of RhoGDI2 expression inhibits the ability of invasion and migration in pancreatic carcinoma.
24721928 RhoGDI2 overexpression is associated with tumor growth, metastasis, and chemoresistance in gastric cancer.
24554735 RhoGDI2 inhibits trophoblast cell migration, and this function may involve suppression of RAC1 activation.
24185104 14-3-3sigma is a RhoGDI2-regulated gene that appears to be important for suppressing the chemoresistance of gastric cancer cells.
23232495 These results suggest that RhoGDIbeta has mitotic functions, including regulation of cytokinesis and bipolar spindle formation
23206989 Expression of ARHGDIB variants 6a, 6b, and 6c appears to be restricted to cancer cells and normal placental tissue, suggesting that these variants possess cancer-specific functions.
More...

AA Sequence

MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT      1 - 70
RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT     71 - 140
FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE             141 - 201
//

Text Mined References (76)

PMID Year Title
26707877 2016 An adventitious interaction of filamin A with RhoGDI2(Tyr153Glu).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562149 2014 Mechanisms of RhoGDI2 mediated lung cancer epithelial-mesenchymal transition suppression.
25516960 2015 RhoC Is an Unexpected Target of RhoGDI2 in Prevention of Lung Colonization of Bladder Cancer.
25266803 2015 RNA interference-mediated knockdown of RhoGDI2 induces the migration and invasion of human lung cancer A549 cells via activating the PI3K/Akt pathway.
24788627 2014 Depletion of RhoGDI2 expression inhibits the ability of invasion and migration in pancreatic carcinoma.
24721928 2014 RhoGDI2 promotes epithelial-mesenchymal transition via induction of Snail in gastric cancer cells.
24554735 2014 RhoGDI2 is expressed in human trophoblasts and involved in their migration by inhibiting the activation of RAC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185104 2013 14-3-3? attenuates RhoGDI2-induced cisplatin resistance through activation of Erk and p38 in gastric cancer cells.
More...