Property Summary

NCBI Gene PubMed Count 110
Grant Count 92
R01 Count 67
Funding $5,794,448.68
PubMed Score 360.52
PubTator Score 160.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
psoriasis -1.600 0.000
non diabetic and post-ischemic heart fai... -1.100 0.003
glioblastoma 1.400 0.012
medulloblastoma, large-cell 1.200 0.001
lung cancer 1.100 0.013
pediatric high grade glioma 1.400 0.007
group 4 medulloblastoma 1.500 0.010
COPD -1.500 0.028
Polycystic Ovary Syndrome -2.118 0.023
breast carcinoma 1.100 0.000
Pick disease -1.300 0.000
acute myeloid leukemia 1.900 0.004
ovarian cancer 1.100 0.000

Synonym

Accession P52565 A8MXW0 B2R5X1 B4DDD3 B4DUV9 Q6IBM5 Rho GDI 1
Symbols GDIA1
NPHS8
RHOGDI
RHOGDI-1
HEL-S-47e

Gene

PDB

1HH4   1CC0   1FSO   1FST   1FT0   1FT3   1KMT   1QVY   1RHO   2BXW   2JHS   2JHT   2JHU   2JHV   2JHW   2JHX   2JHY   2JHZ   2JI0   2N80  

Gene RIF (53)

PMID Text
26719334 RHOGDI alpha acetylation interferes with Rho signaling, resulting in alteration of cellular filamentous actin.
26646181 RIP2 and RhoGDI bind to p75(NTR) death domain at partially overlapping epitopes with over 100-fold difference in affinity, revealing the mechanism by which RIP2 recruitment displaces RhoGDI upon ligand binding.
26460549 MiR-25 is activated by the WNT/beta-catenin signaling pathway, and exerts its pro-metastatic function by directly inhibiting the Rho GDP dissociation inhibitor alpha (RhoGDI1). Downregulation of RhoGDI1 enhances expression of Snail, thereby promoting EMT.
26416248 Downregulation of RhoGDI could be a critical mechanism of breast tumor development, which may involve the hyperactivation of Rho GTPases and upregulation of COX-2 activity.
25981171 This study showed that ARHGD1A messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25874870 HIV-1 Nef downregulates the expression of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) protein in Nef-transfected SupT1 cells
24859471 the present study has identified loss of ARHGDIA contributed to the processes of hepatic tumorigenesis, in particular invasion and metastasis
24820414 Results identify a critical role for 14-3-3tau in promoting breast cancer metastasis, in part through binding to and inhibition of RhoGDIalpha, a negative regulator of Rho GTPases and a metastasis suppressor.
24710410 By directly targeting the Rho GDP dissociation inhibitor alpha (RhoGDI1) and activated leukocyte cell adhesion molecule (ALCAM).
24374343 Our findings suggest that RhoGDI overexpression is a predictor of distant metastasis and plays an important role in the progression of hepatocellular carcinoma
More...

AA Sequence

MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV      1 - 70
VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID     71 - 140
KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD          141 - 204
//

Text Mined References (120)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26719334 2016 Structural and Mechanistic Insights into the Regulation of the Fundamental Rho Regulator RhoGDI? by Lysine Acetylation.
26646181 2015 Structural basis of death domain signaling in the p75 neurotrophin receptor.
26460549 2015 MiR-25 promotes hepatocellular carcinoma cell growth, migration and invasion by inhibiting RhoGDI1.
26416248 2015 RhoGDI deficiency induces constitutive activation of Rho GTPases and COX-2 pathways in association with breast cancer progression.
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...