Property Summary

NCBI Gene PubMed Count 75
Grant Count 90
R01 Count 79
Funding $4,134,005.28
PubMed Score 67.54
PubTator Score 95.33

Knowledge Summary

Patent (18,365)

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.031
gastric cancer 1.400 0.005
pancreatic cancer 1.200 0.004
Chronic Lymphocytic Leukemia 1.086 0.007
malignant mesothelioma -1.800 0.000
psoriasis -1.600 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001
glioblastoma -1.800 0.000
tuberculosis 2.400 0.000
lung cancer -1.700 0.031
colon cancer -1.400 0.014
diabetes mellitus 1.300 0.003
adult high grade glioma -1.300 0.017
sonic hedgehog group medulloblastoma 1.400 0.015
pancreatic carcinoma 1.200 0.004
Endometriosis -1.316 0.016
inflammatory breast cancer -1.600 0.000

Synonym

Accession P52564 MAP kinase kinase 6
Symbols MEK6
MKK6
MAPKK6
PRKMK6
SAPKK3
SAPKK-3

Gene

PDB

2Y8O   3ENM   3FME   3VN9  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (43)

PMID Text
25214442 Data indicate that mitogen-activated protein kinase kinase 6 (MKK6) levels were substantially higher in monocytes than in neutrophils.
25019214 Data show significant increase in the expression of MKK6 in Esophageal, Stomach, and Colon cancers as compared to controls.
24936062 uncover a new mechanism of deactivation of MKK6-p38 and substantiate a novel regulatory role of FBXO31 in stress response
24742347 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
24742347 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
24085465 Serine phosphorylation of p66shc is carried out by active MKK6. beta-Amyloid-induced ROS production and apoptosis increased in the presence of MKK6 and p66shc, which directly associate.
23744074 The models confirmed the reaction order, revealed processivity in the phosphorylation of MEK6 by ASK1, and suggested that the order of phosphorylation is dictated by both binding and catalysis rates.
23535064 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
23535064 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
23535064 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
More...

AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM      1 - 70
RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY     71 - 140
KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK    141 - 210
TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA    211 - 280
DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD                    281 - 334
//

Text Mined References (82)

PMID Year Title
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25214442 2014 Monocytic cell differentiation from band-stage neutrophils under inflammatory conditions via MKK6 activation.
25019214 2014 MKK6 is upregulated in human esophageal, stomach, and colon cancers.
24936062 2014 F-box only protein 31 (FBXO31) negatively regulates p38 mitogen-activated protein kinase (MAPK) signaling by mediating lysine 48-linked ubiquitination and degradation of mitogen-activated protein kinase kinase 6 (MKK6).
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24085465 2014 ?-Amyloid-evoked apoptotic cell death is mediated through MKK6-p66shc pathway.
23744074 2013 Precisely ordered phosphorylation reactions in the p38 mitogen-activated protein (MAP) kinase cascade.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22383536 2012 Crystal structure of non-phosphorylated MAP2K6 in a putative auto-inhibition state.
More...