Property Summary

NCBI Gene PubMed Count 80
PubMed Score 28.79
PubTator Score 8.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52435 A5D6V8 O43375 RNA polymerase II subunit B11-a
Symbols RPB11
RPB11A
RPB11m
hRPB14
POLR2J1

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD  

Gene RIF (86)

PMID Text
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
More...

AA Sequence

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK      1 - 70
IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE                            71 - 117
//

Text Mined References (82)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22022972 2011 A minor isoform of the human RNA polymerase II subunit hRPB11 (POLR2J) interacts with several components of the translation initiation factor eIF3.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
16341674 2005 Transcriptome analysis of human gastric cancer.
15586814 [New genes on human chromosome 7: bioinformatic analysis of a gene cluster from the POLR2J family].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12887902 2003 Acetylation of Tat defines a cyclinT1-independent step in HIV transactivation.
More...