Property Summary

NCBI Gene PubMed Count 33
PubMed Score 41.95
PubTator Score 33.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 1.4e-04
astrocytic glioma -1.300 6.0e-03
Astrocytoma, Pilocytic -1.300 1.6e-05
atypical teratoid / rhabdoid tumor -1.600 3.3e-09
ependymoma -1.400 9.3e-03
glioblastoma -1.400 1.8e-08
group 3 medulloblastoma -1.100 8.0e-03
lung cancer -2.900 4.4e-05
lung carcinoma 1.200 2.1e-09
malignant mesothelioma -3.500 1.4e-07
medulloblastoma, large-cell -1.800 1.2e-03
oligodendroglioma -1.200 1.7e-02
osteosarcoma -1.604 1.5e-06
Pick disease -1.200 3.2e-03
primitive neuroectodermal tumor -1.200 1.0e-03

Gene RIF (22)

AA Sequence

MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQ      1 - 70
PTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMV     71 - 140
CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLA    141 - 210
SKLGKQWTPLIILANSRSGTNMGEGLLGEFRILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGD    211 - 280
GTVGWVLDAVDDMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRW    281 - 350
KVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQEC    351 - 420
KDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQ    421 - 490
IQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHAMMLYFSGEQTDDDISSTSDQ    491 - 560
EDIKATE                                                                   561 - 567
//

Text Mined References (35)

PMID Year Title