Property Summary

Ligand Count 621
NCBI Gene PubMed Count 183
PubMed Score 453.65
PubTator Score 330.40

Knowledge Summary

Patent (132,317)

TINX Plot

  Disease (6)

Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count Z-score Confidence
Cancer 2499 4.42 2.2
Polycythemia vera 27 3.41 1.7
Lactocele 3 3.001 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis 1.300 2.0e-03
ductal carcinoma in situ 1.100 2.3e-02
group 3 medulloblastoma -1.800 7.7e-07
head and neck cancer and chronic obstruc... 1.400 1.7e-03
interstitial cystitis 2.600 2.1e-04
lung adenocarcinoma 1.200 1.2e-04
medulloblastoma, large-cell -1.400 1.2e-04
oligodendroglioma -1.100 1.3e-02
osteosarcoma 1.283 1.0e-06
ovarian cancer 1.200 1.4e-04
periodontitis 1.100 2.7e-26
posterior fossa group B ependymoma -1.100 7.7e-06
primitive neuroectodermal tumor -1.500 3.9e-04
psoriasis 1.200 1.1e-04
ulcerative colitis 1.900 7.8e-05

Protein-protein Interaction (2)

Gene RIF (147)

AA Sequence

MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSL      1 - 70
FALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGLRKDLASAILDLPVLEHLFAQ     71 - 140
HRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTR    141 - 210
RRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIA    211 - 280
WTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR    281 - 350
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP    351 - 420
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQR    421 - 490
GHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDA    491 - 560
KHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQ    561 - 630
LAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQ    631 - 700
TLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSF    701 - 770
RAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR    771 - 840
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCL    841 - 910
RDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDY    911 - 980
YVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRL    981 - 1050
LELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHS   1051 - 1120
LSFS                                                                     1121 - 1124
//

Text Mined References (189)

PMID Year Title