Property Summary

NCBI Gene PubMed Count 173
Grant Count 234
R01 Count 139
Funding $17,411,255.71
PubMed Score 419.19
PubTator Score 330.40

Knowledge Summary

Patent (132,317)

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma -1.100 0.013
psoriasis 1.300 0.000
osteosarcoma -3.385 0.000
group 3 medulloblastoma -1.800 0.000
periodontitis 1.100 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.500 0.000
Atopic dermatitis 1.300 0.002
interstitial cystitis 2.600 0.000
posterior fossa group B ependymoma -1.100 0.000
lung adenocarcinoma 1.200 0.000
ductal carcinoma in situ 1.100 0.023
ulcerative colitis 1.900 0.000
ovarian cancer 1.200 0.000
head and neck cancer and chronic obstruc... 1.400 0.002

Synonym

Accession P52333 Q13259 Q13260 Q13611 Q8N1E8 Q99699 Q9Y6S2
Symbols JAKL
LJAK
JAK-3
L-JAK
JAK3_HUMAN

Gene

PDB

1YVJ   3LXK   3LXL   3PJC   3ZC6   3ZEP   4HVD   4HVG   4HVH   4HVI   4I6Q   4QPS   4QT1   4RIO   4V0G   4Z16  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (137)

PMID Text
27077371 Foxp3 has a rapid turn over in Treg partly controlled at the transcriptional level by the JAK/STAT pathway
27063186 JAK3 and MCL-1 were down-regulated in patient CD8(+) T cells versus their normal counterparts, likely due to defective suppressor activity of miR-29b and miR-198 in RCC CD8(+) T cells.
26917488 Results confirm that JAK3 is mutated in T-PLL and underscore the potential therapeutical relevance of epigenetic regulator.
26829670 interleukin-4 regulates hematopoietic lineage choice by activating the JAK3-STAT6 pathway, which causes dendritic-cell-specific DNA demethylation.
26769277 Study describes three patients with a novel deep intronic mis-splicing mutation in JAK3 as a cause of T-B+NK- severe combined immunodeficiency.
26666525 This study showed that JAK3 is a powerful negative regulator of the creatine transporter SLC6A8.
26565811 N225K and A550V PTPN6 mutations cause loss-of-function leading to JAK3 mediated deregulation of STAT3 pathway and uncover a mechanism that tumor cells can use to control PTPN6 substrate specificity.
26493028 Study shows JAK3 mutations in 16% of patients with T-cell prolymphocytic leukemia which might be an important prognostic marker.
26451047 Jak3 has a role in promoting mucosal tolerance through suppressed expression and limiting activation of TLRs thereby preventing intestinal and systemic chronic low-grade inflammation and associated obesity and MetS
26248889 Letter/Case Report: ersistent rotavirus diarrhea post-transplant in a novel JAK3-SCID patient after vaccination.
More...

AA Sequence

MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSL      1 - 70
FALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGLRKDLASAILDLPVLEHLFAQ     71 - 140
HRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTR    141 - 210
RRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIA    211 - 280
WTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR    281 - 350
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP    351 - 420
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQR    421 - 490
GHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDA    491 - 560
KHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQ    561 - 630
LAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQ    631 - 700
TLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSF    701 - 770
RAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR    771 - 840
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCL    841 - 910
RDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDY    911 - 980
YVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRL    981 - 1050
LELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHS   1051 - 1120
LSFS                                                                     1121 - 1124
//

Text Mined References (179)

PMID Year Title
27077371 2016 Inhibition of the JAK/STAT Signaling Pathway in Regulatory T Cells Reveals a Very Dynamic Regulation of Foxp3 Expression.
27063186 2016 miR-29b and miR-198 overexpression in CD8+ T cells of renal cell carcinoma patients down-modulates JAK3 and MCL-1 leading to immune dysfunction.
26917488 2016 Genes encoding members of the JAK-STAT pathway or epigenetic regulators are recurrently mutated in T-cell prolymphocytic leukaemia.
26829670 2016 External signals shape the epigenome.
26769277 2016 Deep intronic mis-splicing mutation in JAK3 gene underlies T-B+NK- severe combined immunodeficiency phenotype.
26666525 2015 Regulation of the Na+,Cl- Coupled Creatine Transporter CreaT (SLC6A8) by the Janus Kinase JAK3.
26565811 2015 Loss of function mutations in PTPN6 promote STAT3 deregulation via JAK3 kinase in diffuse large B-cell lymphoma.
26493028 2016 Genetic characterization of T-PLL reveals two major biologic subgroups and JAK3 mutations as prognostic marker.
26451047 2015 Role of Janus Kinase 3 in Predisposition to Obesity-associated Metabolic Syndrome.
26248889 2016 Persistent rotavirus diarrhea post-transplant in a novel JAK3-SCID patient after vaccination.
More...