Property Summary

NCBI Gene PubMed Count 26
Grant Count 23
R01 Count 19
Funding $1,292,542.73
PubMed Score 18.25
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.800 0.007
ependymoma -1.800 0.011
oligodendroglioma -1.400 0.024
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
group 4 medulloblastoma -1.300 0.000
primitive neuroectodermal tumor -1.200 0.000
tuberculosis and treatment for 6 months 1.200 0.000
lung cancer 2.100 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.065 0.026
ovarian cancer 2.200 0.000

Gene RIF (18)

PMID Text
26814130 DiRas1 expression inhibits malignant features of cancers in part by nonproductively binding to SmgGDS and inhibiting the binding of other small GTPases to SmgGDS
26598509 results indicate that statins selectively up-regulate SmgGDS in endothelial cells, for which the beta1-integrin/Akt1 pathway may be involved, demonstrating the novel aspects of the pleiotropic effects of statins
24552806 SmgGDS promotes cell cycle progression in multiple types of cancer, making SmgGDS a valuable target for cancer therapeutics.
24415755 this study provides evidence that SmgGDS-607 associates with GTPases through recognition of the last amino acid in the CAAX motif.
24349085 TG2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24197117 findings identify SmgGDS-558 as an activator of RhoA and NF-kB in breast cancer, and demonstrate a functional role for SmgGDS-558 in the proliferation of breast cancer cells and tumorigenesis.
23898208 HIV-1 Tat downregulates the expression of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1; GDS1) in human primary T cells
23640485 These results indicate that statins exert their pleiotropic effects through SmgGDS upregulation with a resultant Rac1 degradation and reduced oxidative stress in animals and humans.
21429211 findings provide compelling evidence of a novel role for junctional adhesion molecule-A (JAM-A)in driving breast cancer cell migration via activation of Rap1 GTPase and beta1-integrin
21242305 Results indicate that SmgGDS is a bona fide GEF that specifically activates RhoA and RhoC through a unique mechanism not used by other Rho family exchange factors.
More...

AA Sequence

MDNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFASLLTPQSSCKAKVAN      1 - 70
IIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHL     71 - 140
RSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLA    141 - 210
ELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDS    211 - 280
DKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANC    281 - 350
IHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQF    351 - 420
KLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG    421 - 490
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC    491 - 560
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES                           561 - 607
//

Text Mined References (30)

PMID Year Title
26814130 2016 The Tumor-suppressive Small GTPase DiRas1 Binds the Noncanonical Guanine Nucleotide Exchange Factor SmgGDS and Antagonizes SmgGDS Interactions with Oncogenic Small GTPases.
26598509 2016 Statins up-regulate SmgGDS through ?1-integrin/Akt1 pathway in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
24552806 2014 SmgGDS-558 regulates the cell cycle in pancreatic, non-small cell lung, and breast cancers.
24415755 2014 The chaperone protein SmgGDS interacts with small GTPases entering the prenylation pathway by recognizing the last amino acid in the CAAX motif.
24349085 2013 Transglutaminase 2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24197117 2014 The SmgGDS splice variant SmgGDS-558 is a key promoter of tumor growth and RhoA signaling in breast cancer.
23640485 2013 Statins exert the pleiotropic effects through small GTP-binding protein dissociation stimulator upregulation with a resultant Rac1 degradation.
21429211 2011 Breast cancer cell migration is regulated through junctional adhesion molecule-A-mediated activation of Rap1 GTPase.
21269460 2011 Initial characterization of the human central proteome.
More...