Property Summary

NCBI Gene PubMed Count 30
PubMed Score 21.34
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 3.3e-07
astrocytic glioma -1.800 7.5e-03
Astrocytoma, Pilocytic -1.200 7.2e-08
atypical teratoid / rhabdoid tumor -1.800 3.2e-05
ependymoma -1.800 1.1e-02
glioblastoma -1.300 1.6e-07
group 4 medulloblastoma -1.300 1.7e-05
lung cancer 2.100 3.8e-04
oligodendroglioma -1.400 2.4e-02
ovarian cancer 2.200 2.0e-05
primitive neuroectodermal tumor -1.200 2.5e-04
subependymal giant cell astrocytoma -1.065 2.6e-02
tuberculosis and treatment for 6 months 1.200 1.4e-04

Gene RIF (23)

AA Sequence

MDNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFASLLTPQSSCKAKVAN      1 - 70
IIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHL     71 - 140
RSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLA    141 - 210
ELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDS    211 - 280
DKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANC    281 - 350
IHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQF    351 - 420
KLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG    421 - 490
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC    491 - 560
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES                           561 - 607
//

Text Mined References (34)

PMID Year Title