Property Summary

NCBI Gene PubMed Count 118
PubMed Score 85.31
PubTator Score 63.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.7e-04
atypical teratoid / rhabdoid tumor -1.400 1.7e-05
Breast cancer 2.600 2.5e-02
dermatomyositis -1.300 5.5e-04
glioblastoma -1.100 1.2e-04
hereditary spastic paraplegia -1.104 8.2e-03
lung cancer 1.100 3.2e-02
malignant mesothelioma 1.100 1.4e-06
medulloblastoma -1.100 9.7e-04
medulloblastoma, large-cell -1.200 3.0e-04
non-small cell lung cancer 1.526 4.8e-16
osteosarcoma -2.154 3.2e-09
ovarian cancer 1.200 3.5e-03
Pick disease -1.400 3.4e-05
psoriasis -1.400 3.8e-04
tuberculosis and treatment for 3 months -1.100 2.6e-05

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (92)

AA Sequence

MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEA      1 - 70
QISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKEN     71 - 140
CTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDC    141 - 210
NILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSY    211 - 280
LSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSP    281 - 350
KESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV    351 - 420
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQ    421 - 490
EIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL                          491 - 538
//

Text Mined References (125)

PMID Year Title