Property Summary

NCBI Gene PubMed Count 112
PubMed Score 77.00
PubTator Score 63.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
non-small cell lung cancer 2798 4.76155152600713E-16
osteosarcoma 7933 3.17579266985788E-9
ovarian cancer 8492 6.69592740818536E-7
malignant mesothelioma 3163 1.16303280868912E-6
medulloblastoma, large-cell 6234 2.63411501946329E-6
psoriasis 6685 7.70459803856375E-6
atypical teratoid / rhabdoid tumor 4369 1.69019843651155E-5
Pick disease 1893 3.44064795230167E-5
pediatric high grade glioma 2712 3.50979364248432E-5
glioblastoma 5572 5.83304965772706E-5
tuberculosis and treatment for 3 months 327 8.93881666555588E-5
dermatomyositis 967 5.4736531600191E-4
medulloblastoma 1524 9.66948516827962E-4
hereditary spastic paraplegia 313 0.00818521402853086
Breast cancer 3099 0.0250450794678322
lung cancer 4473 0.0324022761220509
Disease Target Count Z-score Confidence
Cancer 2346 3.209 1.6

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -3.300 0.000
osteosarcoma -2.154 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -1.800 0.000
hereditary spastic paraplegia -1.104 0.008
tuberculosis and treatment for 3 months -1.200 0.000
non-small cell lung cancer 1.526 0.000
lung cancer 1.100 0.032
Breast cancer 2.600 0.025
pediatric high grade glioma -1.100 0.000
Pick disease -1.400 0.000
ovarian cancer 2.100 0.000
dermatomyositis -1.300 0.001

Synonym

Accession P52294 D3DN93 Q6IBQ9 Q9BQ56
Symbols RCH2
SRP1
IPOA5
NPI-1

Gene

PANTHER Protein Class (1)

PDB

3TJ3   2JDQ   4B18  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (89)

PMID Text
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25272585 Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7.
24744753 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
24284509 miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy
24269683 Results indicate CTNNBL1 as a unique selective nuclear localization signals (NLSs)-binding protein with striking differences from karyopherin-alphas.
23425335 This supports the notion that de novo mutations KPNA1 in are extremely rare in schizophrenia
22509482 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22422068 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22399302 mTOR and protein phosphatase 2A catalytically control the constitutive nuclear import of latent STAT1 by KPNA1, which are key modulators of STAT1 expression and apoptosis.
More...

AA Sequence

MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEA      1 - 70
QISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKEN     71 - 140
CTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDC    141 - 210
NILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSY    211 - 280
LSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSP    281 - 350
KESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV    351 - 420
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQ    421 - 490
EIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL                          491 - 538
//

Text Mined References (119)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272585 2014 [Identification of prototype foamy virus Bel1 nuclear localization signal and its corresponding importins].
24284509 2014 MiR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin ?4 and ?5 in IgA nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269683 2014 Structural and mutational analysis reveals that CTNNBL1 binds NLSs in a manner distinct from that of its closest armadillo-relative, karyopherin ?.
23425335 2013 Investigation of rare variants in LRP1, KPNA1, ALS2CL and ZNF480 genes in schizophrenia patients reflects genetic heterogeneity of the disease.
More...