Property Summary

NCBI Gene PubMed Count 112
Grant Count 7
R01 Count 5
Funding $687,539.3
PubMed Score 77.00
PubTator Score 63.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -3.300 0.000
osteosarcoma -2.154 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -1.800 0.000
hereditary spastic paraplegia -1.104 0.008
tuberculosis and treatment for 3 months -1.200 0.000
non-small cell lung cancer 1.526 0.000
lung cancer 1.100 0.032
Breast cancer 2.600 0.025
pediatric high grade glioma -1.100 0.000
Pick disease -1.400 0.000
ovarian cancer 2.100 0.000
dermatomyositis -1.300 0.001

Synonym

Accession P52294 D3DN93 Q6IBQ9 Q9BQ56
Symbols RCH2
SRP1
IPOA5
NPI-1

Gene

PANTHER Protein Class (1)

PDB

3TJ3   2JDQ   4B18  

Protein-protein Interaction (3)

Gene RIF (121)

PMID Text
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25272585 Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7.
24744753 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
24284509 miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy
24269683 Results indicate CTNNBL1 as a unique selective nuclear localization signals (NLSs)-binding protein with striking differences from karyopherin-alphas.
23425335 This supports the notion that de novo mutations KPNA1 in are extremely rare in schizophrenia
22509482 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22422068 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22422068 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
More...

AA Sequence

MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEA      1 - 70
QISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKEN     71 - 140
CTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDC    141 - 210
NILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSY    211 - 280
LSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSP    281 - 350
KESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV    351 - 420
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQ    421 - 490
EIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL                          491 - 538
//

Publication (119)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272585 2014 [Identification of prototype foamy virus Bel1 nuclear localization signal and its corresponding importins].
24284509 2014 MiR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin ?4 and ?5 in IgA nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269683 2014 Structural and mutational analysis reveals that CTNNBL1 binds NLSs in a manner distinct from that of its closest armadillo-relative, karyopherin ?.
23425335 2013 Investigation of rare variants in LRP1, KPNA1, ALS2CL and ZNF480 genes in schizophrenia patients reflects genetic heterogeneity of the disease.
More...