Property Summary

NCBI Gene PubMed Count 189
PubMed Score 86.17
PubTator Score 136.45

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 3.96747914393869E-262
non-small cell lung carcinoma 413 6.28472998257903E-19
lung adenocarcinoma 2714 7.75618062904858E-11
acute myeloid leukemia 785 0.0387058112335379
Disease Target Count Z-score Confidence
Nijmegen breakage syndrome 23 3.608 1.8
Cancer 2346 3.389 1.7


  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.300 0.000
non-small cell lung carcinoma 1.300 0.000
acute myeloid leukemia 1.100 0.039
psoriasis 1.800 0.000


Accession P52292 B9EJD6 Q53YE3 Q9BRU5
Symbols QIP2


PANTHER Protein Class (1)


1QGK   1QGR   1EFX   3FEX   3FEY   3WPT   4E4V   4WV6  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
435026 confirmatory 407 / 3 / 606 Fluorescence Cell-Free Homogeneous Counterscreen to Identify Inhibitors of the RanGTP-Importin-beta complex.
493094 confirmatory 13 / 0 / 27 Conterscreen for target specificity Measured in Cell-Free Homogeneous System Using Plate Reader - 2041-02_Inhibitor_Dose_DryPowder_Activity

Gene RIF (149)

26884852 The combination of low nuclear and cytoplasmic KPNA2 expression is associated with adverse outcome in head and neck squamous cell carcinoma treated with radio(chemo)therapy.
26663089 High KPNA2 expression was found to be associated with poor prognosis and resistance to hyperthermochemoradiation therapy (HCRT).
26626145 KPNA2 might play an important role in colorectal carcinogenesis and functions as a novel prognostic indicator and a potential therapeutic target for colorectal cancer.
26553592 provided support for a link between autophagy and epithelial-to-mesenchymal (-like) transition status in WT TP53 glioblastoma cells and provided evidence for the signaling pathway (MIR517C-KPNA2-cytoplasmic TP53) involved in attenuating autophagy
26491019 RBBP4 functions as a novel regulatory factor to increase the efficiency of importin alpha/beta-mediated nuclear import
26209501 High KPNA2 expression is associated with osteoarthritis.
26135850 Suggest that KPNA2 may play a key role in the inflammation process of rheumatoid arthritis via NF-kappaB P65 signal transduction pathway.
25989275 This study provides further evidence for the complexity of DDR mechanism in BC, and that KNPA2 has a role in the aberrant subcellular localisation of DDR proteins with subsequent impaired function.
25956057 High KPNA2 immunoreactivity is a predictor of bladder recurrence and poor survival in patients with upper tract urothelial carcinoma treated with radical nephroureterectomy.
25862856 OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC

AA Sequence

LIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF                                   491 - 529

Text Mined References (201)

PMID Year Title
26884852 2015 Low cytoplasmic and nuclear KPNA2 expression in radiotherapy-treated head and neck squamous cell cancer is associated with an adverse outcome.
26663089 2016 KPNA2 over-expression is a potential marker of prognosis and therapeutic sensitivity in colorectal cancer patients.
26626145 2015 Karyopherin alpha 2 is a novel prognostic marker and a potential therapeutic target for colon cancer.
26553592 2015 MIR517C inhibits autophagy and the epithelial-to-mesenchymal (-like) transition phenotype in human glioblastoma through KPNA2-dependent disruption of TP53 nuclear translocation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491019 2015 Retinoblastoma-binding Protein 4-regulated Classical Nuclear Transport Is Involved in Cellular Senescence.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26209501 2015 KPNA2 interacts with P65 to modulate catabolic events in osteoarthritis.
26135850 2015 KPNA2 Contributes to the Inflammatory Processes in Synovial Tissue of Patients with Rheumatoid Arthritis and SW982 Cells.
25989275 2015 KPNA2 is a nuclear export protein that contributes to aberrant localisation of key proteins and poor prognosis of breast cancer.