Property Summary

NCBI Gene PubMed Count 206
PubMed Score 84.51
PubTator Score 136.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.0e-262
non-small cell lung carcinoma 317 6.3e-19
lung adenocarcinoma 2716 7.8e-11
acute myeloid leukemia 783 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Nijmegen breakage syndrome 24 3.544 1.8
Cancer 2499 3.521 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.100 3.9e-02
lung adenocarcinoma 1.300 7.8e-11
non-small cell lung carcinoma 1.300 6.3e-19
psoriasis 1.800 4.0e-262

Protein-protein Interaction (7)

Gene RIF (161)

AA Sequence

MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNN      1 - 70
QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES     71 - 140
AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLL    141 - 210
ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD    211 - 280
GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN    281 - 350
IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG    351 - 420
IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS    421 - 490
LIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF                                   491 - 529
//

Text Mined References (218)

PMID Year Title