Property Summary

NCBI Gene PubMed Count 49
PubMed Score 42.84
PubTator Score 634.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.40547051736924E-7
acute quadriplegic myopathy 1157 3.90059424101157E-6
medulloblastoma, large-cell 6234 1.46384994826999E-5
psoriasis 6685 1.56874476300867E-4
group 3 medulloblastoma 2254 1.6835919607833E-4
dermatomyositis 967 3.55409125108745E-4
Multiple myeloma 1328 5.16896350172599E-4
ovarian cancer 8492 7.6313166205021E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00103409954909975
diabetes mellitus 1663 0.00104821351867176
pancreatic cancer 2300 0.00263457198585037
primary pancreatic ductal adenocarcinoma 1271 0.00267689340408436
acute myeloid leukemia 785 0.00611322962123557
Waldenstrons macroglobulinemia 765 0.006878041496
astrocytoma 1493 0.00735524547578268
non diabetic and post-ischemic heart failure 200 0.0200180413155669
Subcutaneous panniculitis-like T-cell lymphoma 16 0.029688956879252
subependymal giant cell astrocytoma 2287 0.0360933659011667

Expression

Synonym

Accession P52272 Q15584 Q8WZ44 Q96H56 Q9BWL9 Q9Y492 hnRNP M
Symbols CEAR
HNRPM
HTGR1
NAGR1
HNRPM4
HNRNPM4
hnRNP M

Gene

PDB

2DGV   2DH9   2DO0   2OT8  

  Ortholog (11)

Gene RIF (17)

PMID Text
26332123 p54nrb and hnRNPM knockdown silences the FGF1 promoter-dependent accumulation of mRNA during myoblast differentiation.
25926642 The authors propose that cleavage of and subverting the function of hnRNPM by 3C protease is a general strategy utilized by picornaviruses to facilitate viral infection.
25684943 Results suggest that glyceraldehyde-modified hnRNPM alters gene expression in nonalcoholic fatty liver disease.
25631074 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25496916 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25013050 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24968937 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24840202 findings demonstrate a novel molecular mechanism through which tumor metastasis is endowed by the hnRNPM-mediated splicing program.
24533984 Our results provide a clue that hnRNP M is a potential therapeutic target for Spinal muscular atrophy
24474660 our data suggest that TAF15 and TLS/FUS operate within similar but not identical hnRNP M-TET protein complexes to influence the transcriptional or post-transcriptional output of a particular cell type.
More...

AA Sequence

MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKR      1 - 70
YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGR     71 - 140
PLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGRLGSTVFVAN    141 - 210
LDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDE    211 - 280
RALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGME    281 - 350
GPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG    351 - 420
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIGSGVERMGAGM    421 - 490
GFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGA    491 - 560
NNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNF    561 - 630
GGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFE    631 - 700
SPEVAERACRMMNGMKLSGREIDVRIDRNA                                            701 - 730
//

Text Mined References (66)

PMID Year Title
26332123 2015 Promoter-Dependent Translation Controlled by p54nrb and hnRNPM during Myoblast Differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926642 2015 Heterogeneous Nuclear Ribonucleoprotein M Facilitates Enterovirus Infection.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25684943 2015 In vitro identification of nonalcoholic fatty liver disease-related protein hnRNPM.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...