Property Summary

NCBI Gene PubMed Count 49
Grant Count 7
R01 Count 2
Funding $1,218,449.7
PubMed Score 42.84
PubTator Score 634.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26332123 p54nrb and hnRNPM knockdown silences the FGF1 promoter-dependent accumulation of mRNA during myoblast differentiation.
25926642 The authors propose that cleavage of and subverting the function of hnRNPM by 3C protease is a general strategy utilized by picornaviruses to facilitate viral infection.
25684943 Results suggest that glyceraldehyde-modified hnRNPM alters gene expression in nonalcoholic fatty liver disease.
25631074 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25496916 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25013050 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24968937 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24840202 findings demonstrate a novel molecular mechanism through which tumor metastasis is endowed by the hnRNPM-mediated splicing program.
24533984 Our results provide a clue that hnRNP M is a potential therapeutic target for Spinal muscular atrophy
24474660 our data suggest that TAF15 and TLS/FUS operate within similar but not identical hnRNP M-TET protein complexes to influence the transcriptional or post-transcriptional output of a particular cell type.
More...

AA Sequence

MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKR      1 - 70
YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGR     71 - 140
PLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGRLGSTVFVAN    141 - 210
LDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDE    211 - 280
RALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGME    281 - 350
GPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG    351 - 420
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIGSGVERMGAGM    421 - 490
GFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGA    491 - 560
NNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNF    561 - 630
GGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFE    631 - 700
SPEVAERACRMMNGMKLSGREIDVRIDRNA                                            701 - 730
//

Publication (66)

PMID Year Title
26332123 2015 Promoter-Dependent Translation Controlled by p54nrb and hnRNPM during Myoblast Differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926642 2015 Heterogeneous Nuclear Ribonucleoprotein M Facilitates Enterovirus Infection.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25684943 2015 In vitro identification of nonalcoholic fatty liver disease-related protein hnRNPM.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...