Property Summary

Ligand Count 6
NCBI Gene PubMed Count 27
PubMed Score 355.75
PubTator Score 128.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.114 5.0e-07
astrocytoma 1.300 4.6e-02
atypical teratoid / rhabdoid tumor 1.200 2.8e-04
colon cancer 2.400 2.2e-02
diabetes mellitus -1.400 1.4e-02
esophageal adenocarcinoma -2.100 4.1e-02
glioblastoma 1.200 9.8e-03
group 3 medulloblastoma 1.500 4.7e-04
malignant mesothelioma 1.200 3.4e-06
medulloblastoma, large-cell 1.800 9.9e-06
Multiple myeloma 1.289 6.7e-04
osteosarcoma 1.111 2.9e-06
pediatric high grade glioma 1.100 2.6e-05
primitive neuroectodermal tumor 1.300 2.7e-04

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRR      1 - 70
IILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPS     71 - 140
LMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLG    141 - 210
MAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTL    211 - 280
IGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFG    281 - 350
WTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM    351 - 420
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA           421 - 483
//

Text Mined References (32)

PMID Year Title