Property Summary

NCBI Gene PubMed Count 27
Grant Count 6
R01 Count 6
Funding $392,305.75
PubMed Score 348.59
PubTator Score 128.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.289 0.001
malignant mesothelioma 1.200 0.000
esophageal adenocarcinoma -2.100 0.041
osteosarcoma 1.111 0.000
group 3 medulloblastoma 1.500 0.000
astrocytoma 1.300 0.046
glioblastoma 1.200 0.010
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.300 0.000
acute quadriplegic myopathy 1.114 0.000
colon cancer 2.400 0.022
diabetes mellitus -1.400 0.014
pediatric high grade glioma 1.100 0.000

 MGI Term (1)

Protein-protein Interaction (4)

Gene RIF (11)

PMID Text
26479318 Studies indicate link between the 6-phosphogluconate dehydrogenase, oxidative pentose phosphate pathway (PPP) and lipogenesis through Ru-5-P-dependent inhibition of serine/threonine protein kinase LKB1-AMPK signalling.
25042803 Results show that 6PGD activity is upregulated with increased lysine acetylation in primary leukemia cells from human patients, providing mechanistic insights into 6PGD upregulation in cancer cells.
24125036 copy number gain of the PGD gene was consistently identified in cervical cancers but not in the normal tissues
23973484 Expression of 6PGD positively correlates with advancing stage of lung carcinoma. Knockdown of 6PGD by shRNA potently inhibits c-Met tyrosine phosphorylation.
22677172 Glycolytic cancer cells lacking 6-phosphogluconate dehydrogenase metabolize glucose to induce senescence
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21444627 Data suggest that the affinity of Nox2 for NADPH is increased in the presence of 6PGDH on cell stimulation.
20676096 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20675101 Hsa-miR-132 and -212 were negatively correlated with PGD in the prefrontal cortex of individuals affected with schizophrenia and bipolar disorders.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRR      1 - 70
IILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPS     71 - 140
LMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLG    141 - 210
MAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTL    211 - 280
IGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFG    281 - 350
WTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM    351 - 420
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA           421 - 483
//

Publication (32)

PMID Year Title
26479318 2015 6-Phosphogluconate dehydrogenase links oxidative PPP, lipogenesis and tumour growth by inhibiting LKB1-AMPK signalling.
25042803 2014 Lysine acetylation activates 6-phosphogluconate dehydrogenase to promote tumor growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125036 2014 1p36.22 region containing PGD gene is frequently gained in human cervical cancer.
23973484 2013 6-Phosphogluconate dehydrogenase regulates tumor cell migration in vitro by regulating receptor tyrosine kinase c-Met.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22677172 2012 Glycolytic cancer cells lacking 6-phosphogluconate dehydrogenase metabolize glucose to induce senescence.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...