Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 5
Funding $529,818.27
PubMed Score 28.24
PubTator Score 14.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.800 0.000
oligodendroglioma 2.300 0.001
psoriasis -1.700 0.000
glioblastoma multiforme 1.200 0.000
primitive neuroectodermal tumor 1.200 0.031
pilocytic astrocytoma 1.500 0.000
sonic hedgehog group medulloblastoma -1.500 0.002
lung carcinoma 1.200 0.000

Gene RIF (3)

PMID Text
16481321 Rnd2 regulates neurite outgrowth by functioning as the RhoA activator through Pragmin, in contrast to Rnd1 and Rnd3 inhibiting RhoA signaling
16311049 The RND2 mRNA levels increased significantly after gestation in myometria.
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDN      1 - 70
VRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIP     71 - 140
VTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDR    141 - 210
GNEGEIHKDRAKSCNLM                                                         211 - 227
//

Publication (17)

PMID Year Title
24667779 2014 Functional characterization of BRCA1 gene variants by mini-gene splicing assay.
21989022 2011 A de novo complete BRCA1 gene deletion identified in a Spanish woman with early bilateral breast cancer.
16481321 2006 Pragmin, a novel effector of Rnd2 GTPase, stimulates RhoA activity.
16311049 2005 Differences in the gestational pattern of mRNA expression of the Rnd family in rat and human myometria.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14732713 2004 Identification of splicing variants of Rapostlin, a novel RND2 effector that interacts with neural Wiskott-Aldrich syndrome protein and induces neurite branching.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12590651 2003 Rho family GTPase Rnd2 interacts and co-localizes with MgcRacGAP in male germ cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...