Property Summary

NCBI Gene PubMed Count 17
PubMed Score 30.93
PubTator Score 14.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 3.4e-02
Astrocytoma, Pilocytic 1.500 3.2e-04
glioblastoma multiforme 1.200 7.6e-13
lung carcinoma 1.200 2.3e-22
oligodendroglioma 2.300 1.1e-03
primitive neuroectodermal tumor 1.200 3.1e-02
psoriasis -1.700 9.3e-05
sonic hedgehog group medulloblastoma -1.500 2.1e-03

Gene RIF (3)

AA Sequence

MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDN      1 - 70
VRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIP     71 - 140
VTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDR    141 - 210
GNEGEIHKDRAKSCNLM                                                         211 - 227
//

Text Mined References (17)

PMID Year Title