Property Summary

NCBI Gene PubMed Count 19
Grant Count 18
R01 Count 3
Funding $1,215,635.26
PubMed Score 16.49
PubTator Score 15.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.260 0.001
acute quadriplegic myopathy -1.551 0.000
colon cancer -1.200 0.000
breast carcinoma -2.100 0.000
fibroadenoma -2.200 0.012
lung carcinoma 3.000 0.000
ductal carcinoma in situ -1.400 0.002
invasive ductal carcinoma -1.600 0.008

Gene RIF (9)

PMID Text
25152160 individual subfragments of titin and myomesin composed of Fn type III and Ig-like domains can activate expression of two IGF-1 splice forms in cultured myoblasts
22347812 myomesin could act as a highly elastic ribbon to maintain the overall structural organization of the sarcomeric M-band.
21794030 Our results suggest that the downregulation of MBNL proteins should lead to the abnormal splicing of MYOM1 exon 17a in DM1 muscle.
21256114 This missense mutation caused significant changes of biochemical and biophysical properties of myomesin fragments indicating a role in the pathogenesis of hypertrophic cardiomyopathy .
21069531 EH-myomesin levels were up-regulated at least 10 times in dilated cardiomyopathy patients compared to controls.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of myomesin 1 (MYOM1, 185kDa) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15890201 visco-elastic properties of myomesin might be crucial for the stability of the sarcomere
12972258 Results identify muscle-type creatine kinase as a binding partner of a central portion of myomesin and the closely related M-protein.

AA Sequence

MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEAFRRASASSSQ      1 - 70
QQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAKHSLLSGEEKENLPSDYMVPI     71 - 140
FSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITTSKQSTASKQTTASKQSTASKQSTASKQSTA    141 - 210
SRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFI    211 - 280
IKPRSHTVWEKENVKLHCSIAGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQY    281 - 350
RASAMNVKGELSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE    351 - 420
TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYTIRVRMGEYY    421 - 490
EQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCN    491 - 560
DTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEE    561 - 630
EPSEGIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALF    631 - 700
DLAEGKSYCFRVRCSNSAGVGEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVG    701 - 770
YYIEASVAGSGKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS    771 - 840
PDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSETVQEELTPP    841 - 910
PQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVP    911 - 980
GKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGAPSAVSECFKCEEWTIAVPGPPHSLKCSEV    981 - 1050
RKDSLVLQWKPPVHSGRTPVTGYFVDLKEAKAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQ   1051 - 1120
AGVGKPSDLAGPVVAETRPGTKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKG   1121 - 1190
NKTKMTFKDLGMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV   1191 - 1260
RFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHST   1261 - 1330
VVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKVANIKKETHIVWYKDEREISV   1331 - 1400
DEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRLKLVDEAFKELMMEVCKKIALSATDLKIQS   1401 - 1470
TAEGIQLYSFVTYYVEDLKVNWSHNGSAIRYSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGH   1471 - 1540
QKTVDLSGQAYDEAYAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNE   1541 - 1610
KALASDDHCNLKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKG   1611 - 1680
GKKAK                                                                    1681 - 1685
//

Publication (23)

PMID Year Title
25152160 2015 Induction of insulin-like growth factor 1 splice forms by subfragments of myofibrillar proteins.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22347812 2012 Superhelical architecture of the myosin filament-linking protein myomesin with unusual elastic properties.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21794030 2011 Alternative splicing of myomesin 1 gene is aberrantly regulated in myotonic dystrophy type 1.
21256114 2011 A myomesin mutation associated with hypertrophic cardiomyopathy deteriorates dimerisation properties.
21069531 2011 EH-myomesin splice isoform is a novel marker for dilated cardiomyopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18059477 2008 Molecular basis of the C-terminal tail-to-tail assembly of the sarcomeric filament protein myomesin.
16177791 2005 DNA sequence and analysis of human chromosome 18.
More...