Property Summary

NCBI Gene PubMed Count 33
Grant Count 27
R01 Count 17
Funding $2,943,656.55
PubMed Score 56.40
PubTator Score 44.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.161 0.004
esophageal adenocarcinoma -1.700 0.033
psoriasis 1.800 0.000
osteosarcoma 1.729 0.000
medulloblastoma, large-cell 1.100 0.000
pancreatic cancer 1.300 0.000
diabetes mellitus 1.100 0.001
spina bifida -1.849 0.041
ovarian cancer 1.500 0.000

Gene RIF (13)

PMID Text
25962326 The T allele of rs3760776 might repress the transcription of the FUT6 gene.
24953560 In normal colon samples a significant relationship between sLe(x) expression and the ratio between FUT6/B4GALNT2 activities exists, demonstrating for the first time a role for B4GALNT2 in sLe(x) inhibition in vivo
24232099 Results suggest that FUT4-, FUT6- or FUT8-mediated MDR in human HCC is associated with the activation of the PI3K/Akt pathway and the expression of MRP1.
22155250 these results suggest that FUT6 plays an important role in hepatocellular carcinoma growth by regulating the PI3K/Akt signaling pathway.
20965272 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20179215 GALNT14 and FUT3/6 H-scores were significantly higher in non-small cell lung cancer cell lines sensitive to dulanermin and drozitumab versus resistant cell lines
19913121 Observational study of gene-disease association. (HuGE Navigator)
19349624 results suggested that PKR is the primary target for HSV-1 early RNA during induction of FUT3, FUT5, and FUT6
18274891 two defined regions in the 5'-flanking region of the FUT VI transcription start site are critical for FUT VI transcription in HepG2 cells
More...

AA Sequence

MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWP      1 - 70
FNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPS     71 - 140
HCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQ    141 - 210
SLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNY    211 - 280
ERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQ    281 - 350
TRGIAAWFT                                                                 351 - 359
//

Text Mined References (35)

PMID Year Title
25962326 2015 Transcriptional Downregulation by Nucleotide Substitution with the Minor Allele of rs3760776 Located in the Promoter of FUT6 Gene.
24953560 2014 B4GALNT2 gene expression controls the biosynthesis of Sda and sialyl Lewis X antigens in healthy and cancer human gastrointestinal tract.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24232099 2013 FUT family mediates the multidrug resistance of human hepatocellular carcinoma via the PI3K/Akt signaling pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
22155250 2012 Functional analysis of ?1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
20965272 2011 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
More...