| Tbio | Heterogeneous nuclear ribonucleoprotein A3 |
Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Comments
| Disease | log2 FC | p |
|---|---|---|
| Waldenstrons macroglobulinemia | 1.625 | 0.002 |
| Multiple myeloma | 1.675 | 0.002 |
| malignant mesothelioma | 1.100 | 0.000 |
| psoriasis | -1.700 | 0.000 |
| osteosarcoma | -1.114 | 0.001 |
| medulloblastoma, large-cell | 1.200 | 0.000 |
| autosomal dominant Emery-Dreifuss muscul... | 1.030 | 0.003 |
| hereditary spastic paraplegia | -1.006 | 0.027 |
| acute quadriplegic myopathy | 1.228 | 0.000 |
| Breast cancer | 1.900 | 0.040 |
| group 4 medulloblastoma | 1.200 | 0.000 |
| primary Sjogren syndrome | 1.100 | 0.035 |
| lung adenocarcinoma | 1.017 | 0.000 |
| ovarian cancer | -2.200 | 0.000 |
| dermatomyositis | 2.000 | 0.000 |
| PMID | Text |
|---|---|
| 23827524 | The results of this study suggested that mutations in hnRNPA1, A2/B1, and A3 genes are a rare finding in amyotrophic lateral sclerosis. |
| 23166591 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 23125841 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 23125841 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 23125841 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 23125841 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 22546510 | characterization of hnRNP A3 in human and mouse cell lines |
| 22174317 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
| 20600361 | Results suggest that hnRNP A3 is associated with telomere in vivo and acts as a negative regulator of telomere length maintenance. |
| 17919748 | These biochemical properties of hnRNP A3 suggest that hnRNP A3 can participate in telomere regulation in vivo. |
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP 1 - 70 QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY 71 - 140 NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA 141 - 210 GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG 211 - 280 PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS 281 - 350 FGGRSSGSPYGGGYGSGGGSGGYGSRRF 351 - 378 //
| PMID | Year | Title |
|---|---|---|
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| 24129315 | 2014 | Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. |
| 23827524 | 2013 | Analysis of hnRNPA1, A2/B1, and A3 genes in patients with amyotrophic lateral sclerosis. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| 22720776 | 2012 | PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex. |
| 22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
| 22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
| 22546510 | 2012 | Expression profile and interactions of hnRNP A3 within hnRNP/mRNP complexes in mammals. |
| More... |
