Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.50
PubTator Score 11.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.625 0.002
Multiple myeloma 1.675 0.002
malignant mesothelioma 1.100 0.000
psoriasis -1.700 0.000
osteosarcoma -1.114 0.001
medulloblastoma, large-cell 1.200 0.000
autosomal dominant Emery-Dreifuss muscul... 1.030 0.003
hereditary spastic paraplegia -1.006 0.027
acute quadriplegic myopathy 1.228 0.000
Breast cancer 1.900 0.040
group 4 medulloblastoma 1.200 0.000
primary Sjogren syndrome 1.100 0.035
lung adenocarcinoma 1.017 0.000
ovarian cancer -2.200 0.000
dermatomyositis 2.000 0.000

Synonym

Accession P51991 D3DPF4 Q53RW7 Q6URK5 hnRNP A3
Symbols FBRNP
HNRPA3
D10S102
2610510D13Rik

Gene

Gene RIF (10)

PMID Text
23827524 The results of this study suggested that mutations in hnRNPA1, A2/B1, and A3 genes are a rare finding in amyotrophic lateral sclerosis.
23166591 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
22546510 characterization of hnRNP A3 in human and mouse cell lines
22174317 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
20600361 Results suggest that hnRNP A3 is associated with telomere in vivo and acts as a negative regulator of telomere length maintenance.
17919748 These biochemical properties of hnRNP A3 suggest that hnRNP A3 can participate in telomere regulation in vivo.

AA Sequence

MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP      1 - 70
QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY     71 - 140
NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA    141 - 210
GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG    211 - 280
PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS    281 - 350
FGGRSSGSPYGGGYGSGGGSGGYGSRRF                                              351 - 378
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23827524 2013 Analysis of hnRNPA1, A2/B1, and A3 genes in patients with amyotrophic lateral sclerosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22546510 2012 Expression profile and interactions of hnRNP A3 within hnRNP/mRNP complexes in mammals.
More...