Tbio | Heterogeneous nuclear ribonucleoprotein A3 |
Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Comments
Disease | Target Count |
---|---|
Schizophrenia | 503 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 4.26701105741982E-7 |
malignant mesothelioma | 3163 | 7.5947748457016E-6 |
medulloblastoma, large-cell | 6234 | 1.74773965628058E-5 |
acute quadriplegic myopathy | 1157 | 3.33537150644862E-5 |
dermatomyositis | 967 | 8.90653250742309E-5 |
lung adenocarcinoma | 2714 | 2.06470660492303E-4 |
group 4 medulloblastoma | 1875 | 2.64402662865919E-4 |
psoriasis | 6685 | 2.97402671273632E-4 |
osteosarcoma | 7933 | 0.00117368601656791 |
Multiple myeloma | 1328 | 0.00183349349481757 |
Waldenstrons macroglobulinemia | 765 | 0.00225573860691998 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 499 | 0.0034376422332627 |
hereditary spastic paraplegia | 313 | 0.0267791426422964 |
primary Sjogren syndrome | 789 | 0.0345500157559953 |
Breast cancer | 3099 | 0.0397983231372756 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Liver disease | 219 | 0.0 | 1.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Multiple endocrine neoplasia type 2A | 22 | 4.85 | 2.4 |
Multiple endocrine neoplasia type 2B | 16 | 3.261 | 1.6 |
Frontotemporal dementia | 47 | 3.018 | 1.5 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.625 | 0.002 |
Multiple myeloma | 1.675 | 0.002 |
malignant mesothelioma | 1.100 | 0.000 |
psoriasis | -1.700 | 0.000 |
osteosarcoma | -1.114 | 0.001 |
medulloblastoma, large-cell | 1.200 | 0.000 |
autosomal dominant Emery-Dreifuss muscul... | 1.030 | 0.003 |
hereditary spastic paraplegia | -1.006 | 0.027 |
acute quadriplegic myopathy | 1.228 | 0.000 |
Breast cancer | 1.900 | 0.040 |
group 4 medulloblastoma | 1.200 | 0.000 |
primary Sjogren syndrome | 1.100 | 0.035 |
lung adenocarcinoma | 1.017 | 0.000 |
ovarian cancer | -2.200 | 0.000 |
dermatomyositis | 2.000 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA Inparanoid |
Mouse | OMA EggNOG |
Rat | OMA Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
23827524 | The results of this study suggested that mutations in hnRNPA1, A2/B1, and A3 genes are a rare finding in amyotrophic lateral sclerosis. |
23166591 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
23125841 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
22546510 | characterization of hnRNP A3 in human and mouse cell lines |
22174317 | Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells |
20600361 | Results suggest that hnRNP A3 is associated with telomere in vivo and acts as a negative regulator of telomere length maintenance. |
17919748 | These biochemical properties of hnRNP A3 suggest that hnRNP A3 can participate in telomere regulation in vivo. |
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP 1 - 70 QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY 71 - 140 NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA 141 - 210 GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG 211 - 280 PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS 281 - 350 FGGRSSGSPYGGGYGSGGGSGGYGSRRF 351 - 378 //
PMID | Year | Title |
---|---|---|
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24129315 | 2014 | Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. |
23827524 | 2013 | Analysis of hnRNPA1, A2/B1, and A3 genes in patients with amyotrophic lateral sclerosis. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22720776 | 2012 | PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex. |
22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
22546510 | 2012 | Expression profile and interactions of hnRNP A3 within hnRNP/mRNP complexes in mammals. |
More... |