Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.92
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.131 0.003
Multiple myeloma 1.674 0.000
astrocytic glioma -1.500 0.014
medulloblastoma, large-cell -1.200 0.000
lung cancer 1.100 0.001
adult high grade glioma -1.100 0.000
acute myeloid leukemia -1.200 0.024
ovarian cancer 2.100 0.000

Synonym

Accession P51970 B1AM93 Q9Y6N0
Symbols PGIV
CI-19KD
CI-PGIV

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
21310150 Intra-molecular disulfide bridges and the inter-membrane space localization of three Cx(9)C-containing subunits in human: NDUFS5, NDUFB7 and NDUFA8, are proposed.
21310150 This subunit of complex I is localized in the mitochondrial inter-membrane space. The protein contains intra-molecular disulfide bridges in the twin Cx(9)C motif.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDF      1 - 70
FRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPEN     71 - 140
PYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK                                          141 - 172
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
21310150 2011 NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
More...