Property Summary

NCBI Gene PubMed Count 40
PubMed Score 12.37
PubTator Score 20.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.150 6.3e-05
Amyotrophic lateral sclerosis 1.063 3.0e-06
lung cancer 1.400 2.1e-03
Multiple myeloma 1.712 1.0e-04
ovarian cancer 1.300 3.3e-02

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAG      1 - 70
PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWS     71 - 140
PALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT                     141 - 193
//

Text Mined References (47)

PMID Year Title