Property Summary

NCBI Gene PubMed Count 37
Grant Count 5
Funding $469,383.75
PubMed Score 12.05
PubTator Score 20.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.712 0.000
Amyotrophic Lateral Sclerosis 1.063 0.000
acute quadriplegic myopathy 1.150 0.000
lung cancer 1.400 0.002
ovarian cancer 1.300 0.033

Synonym

Accession P51965 B2RBX4 C9J8K2 K4DI90
Symbols UBCH6

Gene

PANTHER Protein Class (1)

PDB

4JJQ   1XR9   3BZH  

 GWAS Trait (1)

Gene RIF (9)

PMID Text
25960396 Auto-ubiquitination of Ube2E1 is intramolecular.RNF4 enhances Ube2E1 self-ubiquitination.
23603909 USP7 is critical in maintaining the steady state levels of UbE2E1 in cells.
19664638 Smallangle X-ray scattering experiments show that the Lys63 tetra-Ub chain is dynamic in solution, adopting an ensemble of conformations that are more compact than the extended form in the crystal.
18976975 Knockdown of ubiquitin-conjugating enzyme E2E 1 (UBE2E1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18845142 Ro52 has both cytoplasmic and nuclear substrates, and mediates ubiquitination through UBE2D1 in the cytoplasm and through UBE2E1 in the nucleus.
18818210 E1 ligase of the proteasome is inhibitd by ziram and has a role in preventing dopaminergic cell damage
18519031 UbcH6 modulates the transcriptional repression activity of ataxin-1 by modulating the degradation of ataxin-1.
18439907 UbcH6 and ataxin-1 are E2-substrate cognate pairs in the ubiquitin-proteasome system.
16428300 isolated ISG15-modified and unmodified UbcH6 proteins, and analyzed their abilities to form thioester intermediates with ubiquitin

AA Sequence

MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAG      1 - 70
PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWS     71 - 140
PALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT                     141 - 193
//

Text Mined References (43)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
25960396 2015 RING E3-Catalyzed E2 Self-Ubiquitination Attenuates the Activity of Ube2E Ubiquitin-Conjugating Enzymes.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
23603909 2013 Ubiquitin-specific protease 7 is a regulator of ubiquitin-conjugating enzyme UbE2E1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19664638 2009 The structure and conformation of Lys63-linked tetraubiquitin.
More...