Property Summary

NCBI Gene PubMed Count 40
PubMed Score 83.97
PubTator Score 69.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 6.0e-07
Breast cancer -1.200 6.2e-05
glioblastoma 1.100 1.6e-03
group 3 medulloblastoma 1.100 4.9e-04
medulloblastoma, large-cell 1.600 4.1e-05
Multiple myeloma 2.026 1.4e-03
ovarian cancer -2.200 2.0e-07
pancreatic cancer -1.200 3.4e-03
primary pancreatic ductal adenocarcinoma -1.192 1.1e-03
ulcerative colitis -1.110 1.2e-03
Waldenstrons macroglobulinemia 1.542 2.6e-03

Protein-protein Interaction (8)

Gene RIF (23)

AA Sequence

MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDT      1 - 70
ETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI     71 - 140
VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIAL    141 - 210
EIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS    211 - 280
YYRITHLPTIPEMVP                                                           281 - 295
//

Text Mined References (42)

PMID Year Title