Property Summary

NCBI Gene PubMed Count 38
PubMed Score 83.17
PubTator Score 69.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Lung Neoplasms 171
Disease Target Count P-value
ovarian cancer 8492 2.01927656312451E-7
atypical teratoid / rhabdoid tumor 4369 5.98475178203882E-7
sonic hedgehog group medulloblastoma 1482 1.22366355445166E-6
medulloblastoma, large-cell 6234 4.06439355383904E-5
Breast cancer 3099 6.17690629253285E-5
primary pancreatic ductal adenocarcinoma 1271 0.0010951813905405
ulcerative colitis 2087 0.00115512891452699
Multiple myeloma 1328 0.00144333185993165
glioblastoma 5572 0.00161400373467112
Waldenstrons macroglobulinemia 765 0.0026135074125653
pancreatic cancer 2300 0.0033750797016965
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.538 1.8

Expression

  Differential Expression (11)

Synonym

Accession P51959 B2R7B2 B4DLW7 D3DQK7 Q15757 Q96L32 Cyclin-G
Symbols CCNG

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (23)

PMID Text
26872615 Results show that miR-23b may inhibit epithelial ovarian tumorigenesis and progression by targeting CCNG1 and modulating the expression of the relevant genes.
26623719 Data show that the miR-27b/cyclin G1 protein (CCNG1)/p53 tumor suppressor protein (P53)/miR-508-5p axis plays important roles in gastric cancer (GC)-associated multidrug resistance (MDR).
25472877 OA induced cell cycle arrest in lung cancer cells through miR-122/Cyclin G1/MEF2D pathway. This finding may contribute to the understanding of the molecular mechanism of OA's anti-tumor activity
25007270 Progesterone-induced cyclin G1 mediates the inhibitory effect of progesterone on endometrial epithelial cell proliferation.
23812426 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23589924 cyclin G1 exerts negative control on proliferation of endometrial carcinoma cells (ECCs).
22835824 cyclin G1 levels were increased in normal tissue compared with hepatocellular carcinoma tissue and vary over the course of the cell cycle, with equal distribution between the nucleus and cytoplasm.
22649121 data suggest that the deficiency of progesterone and its receptors is an important cause of the decreased expression of cyclin G1 in endometrial carcinoma, which may account for carcinogenesis and development of endometrial carcinomas
22271581 Cyclin G1 overexpression enhanced Akt activation through interaction with p85 (regulatory subunit of phosphoinositide 3-kinase)
22105316 Loss of microRNA 122 expression in patients with hepatitis B enhances hepatitis B virus replication through cyclin G(1) -modulated P53 activity.
More...

AA Sequence

MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDT      1 - 70
ETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI     71 - 140
VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIAL    141 - 210
EIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS    211 - 280
YYRITHLPTIPEMVP                                                           281 - 295
//

Text Mined References (40)

PMID Year Title
26872615 2016 MiR-23b targets cyclin G1 and suppresses ovarian cancer tumorigenesis and progression.
26623719 2016 The miR27b-CCNG1-P53-miR-508-5p axis regulates multidrug resistance of gastric cancer.
25472877 2015 Oleanolic acid suppresses the proliferation of lung carcinoma cells by miR-122/Cyclin G1/MEF2D axis.
25416956 2014 A proteome-scale map of the human interactome network.
25007270 2014 Progesterone-induced cyclin G1 inhibits the proliferation of endometrial epithelial cell and its possible molecular mechanism.
23812426 2014 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23589924 2013 Effects of expression of exogenous cyclin G1 on proliferation of human endometrial carcinoma cells.
22835824 The relationship between Cyclin G1 and survival in patients treated surgically for HCC.
22649121 2012 The role of progesterone and its receptor on cyclin G1 expression in endometrial carcinoma cells.
22271581 2012 Cyclin G1-mediated epithelial-mesenchymal transition via phosphoinositide 3-kinase/Akt signaling facilitates liver cancer progression.
More...