Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.49
PubTator Score 12.99

Knowledge Summary

Patent (5,073)

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.008
osteosarcoma -2.258 0.000
lung cancer 1.100 0.007
posterior fossa group B ependymoma 1.200 0.000
pancreatic carcinoma 1.100 0.008
spina bifida -1.042 0.049

Synonym

Accession P51957 A5YM70 B2R633 B7Z200 Q6P576
Symbols NRK2
STK2
pp12301

Gene

 Collection (1)

Gene RIF (6)

PMID Text
22851694 Nek4 as a novel regulator of replicative senescence and the response to double-stranded DNA damage.
21685204 Nek4 interaction with both RPGRIP1 and the RPGRIP1L is involved in cilium assembly.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20103636 Data show that after Taxol treatment, Nek4 promoted microtubule outgrowth, whereas Nek4 deficiency impaired G(2)-M arrest and decreased formation of mitotic-like asters.
19416921 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLAAYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKE      1 - 70
SWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLT     71 - 140
RTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKD    141 - 210
MNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSKNN    211 - 280
IKNGDSQSKPFATVVSGEAESNHEVIHPQPLSSEGSQTYIMGEGKCLSQEKPRASGLLKSPASLKAHTCK    281 - 350
QDLSNTTELATISSVNIDILPAKGRDSVSDGFVQENQPRYLDASNELGGICSISQVEEEMLQDNTKSSAQ    351 - 420
PENLIPMWSSDIVTGEKNEPVKPLQPLIKEQKPKDQSLALSPKLECSGTILAHSNLRLLGSSDSPASASR    421 - 490
VAGITGVCHHAQDQVAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAF    491 - 560
QESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSS    561 - 630
SGPSVRKASLSVAGPGKPQEEDQPLPARRLSSDCSVTQERKQIHCLSEDELSSSTSSTDKSDGDYGEGKG    631 - 700
QTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMP    701 - 770
GSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVRLREHMGEKYTTYSVKARQLKFFEENMN    771 - 840
F//

Text Mined References (23)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22851694 2012 Nek4 regulates entry into replicative senescence and the response to DNA damage in human fibroblasts.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21685204 2011 The ciliopathy-associated protein homologs RPGRIP1 and RPGRIP1L are linked to cilium integrity through interaction with Nek4 serine/threonine kinase.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20103636 2010 Nek4 status differentially alters sensitivity to distinct microtubule poisons.
More...