Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.49
PubTator Score 12.99

Knowledge Summary

Patent (5,073)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
osteosarcoma 7933 1.76021855559893E-7
posterior fossa group B ependymoma 1530 3.86481331152752E-4
lung cancer 4473 0.00730263804971736
pancreatic cancer 2300 0.00755362431359955
pancreatic carcinoma 567 0.00755362431359957
spina bifida 1064 0.0493097698772355
Disease Target Count Z-score Confidence
Mood disorder 10 0.0 2.0
Disease Target Count Z-score Confidence
Meckel syndrome 48 3.907 2.0
Coffin-Lowry syndrome 10 3.329 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.008
osteosarcoma -2.258 0.000
lung cancer 1.100 0.007
posterior fossa group B ependymoma 1.200 0.000
pancreatic carcinoma 1.100 0.008
spina bifida -1.042 0.049

Synonym

Accession P51957 A5YM70 B2R633 B7Z200 Q6P576
Symbols NRK2
STK2
pp12301

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Collection (1)

Pathway (1)

Gene RIF (6)

PMID Text
22851694 Nek4 as a novel regulator of replicative senescence and the response to double-stranded DNA damage.
21685204 Nek4 interaction with both RPGRIP1 and the RPGRIP1L is involved in cilium assembly.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20103636 Data show that after Taxol treatment, Nek4 promoted microtubule outgrowth, whereas Nek4 deficiency impaired G(2)-M arrest and decreased formation of mitotic-like asters.
19416921 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLAAYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKE      1 - 70
SWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLT     71 - 140
RTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKD    141 - 210
MNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSKNN    211 - 280
IKNGDSQSKPFATVVSGEAESNHEVIHPQPLSSEGSQTYIMGEGKCLSQEKPRASGLLKSPASLKAHTCK    281 - 350
QDLSNTTELATISSVNIDILPAKGRDSVSDGFVQENQPRYLDASNELGGICSISQVEEEMLQDNTKSSAQ    351 - 420
PENLIPMWSSDIVTGEKNEPVKPLQPLIKEQKPKDQSLALSPKLECSGTILAHSNLRLLGSSDSPASASR    421 - 490
VAGITGVCHHAQDQVAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAF    491 - 560
QESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSS    561 - 630
SGPSVRKASLSVAGPGKPQEEDQPLPARRLSSDCSVTQERKQIHCLSEDELSSSTSSTDKSDGDYGEGKG    631 - 700
QTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMP    701 - 770
GSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVRLREHMGEKYTTYSVKARQLKFFEENMN    771 - 840
F//

Text Mined References (23)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22851694 2012 Nek4 regulates entry into replicative senescence and the response to DNA damage in human fibroblasts.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21685204 2011 The ciliopathy-associated protein homologs RPGRIP1 and RPGRIP1L are linked to cilium integrity through interaction with Nek4 serine/threonine kinase.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20103636 2010 Nek4 status differentially alters sensitivity to distinct microtubule poisons.
More...