Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.45
PubTator Score 12.99

Knowledge Summary

Patent (5,073)

TINX Plot

  Disease (5)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
osteosarcoma 7950 1.8e-07
posterior fossa group B ependymoma 416 3.9e-04
lung cancer 4740 7.3e-03
pancreatic cancer 2398 7.6e-03
pancreatic carcinoma 562 7.6e-03
spina bifida 1074 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mood disorder 14 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.100 7.3e-03
osteosarcoma -2.258 1.8e-07
pancreatic cancer 1.100 7.6e-03
pancreatic carcinoma 1.100 7.6e-03
posterior fossa group B ependymoma 1.200 3.9e-04
spina bifida -1.042 4.9e-02

Gene RIF (6)

AA Sequence

MPLAAYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKE      1 - 70
SWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLT     71 - 140
RTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKD    141 - 210
MNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSKNN    211 - 280
IKNGDSQSKPFATVVSGEAESNHEVIHPQPLSSEGSQTYIMGEGKCLSQEKPRASGLLKSPASLKAHTCK    281 - 350
QDLSNTTELATISSVNIDILPAKGRDSVSDGFVQENQPRYLDASNELGGICSISQVEEEMLQDNTKSSAQ    351 - 420
PENLIPMWSSDIVTGEKNEPVKPLQPLIKEQKPKDQSLALSPKLECSGTILAHSNLRLLGSSDSPASASR    421 - 490
VAGITGVCHHAQDQVAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAF    491 - 560
QESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSS    561 - 630
SGPSVRKASLSVAGPGKPQEEDQPLPARRLSSDCSVTQERKQIHCLSEDELSSSTSSTDKSDGDYGEGKG    631 - 700
QTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMP    701 - 770
GSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVRLREHMGEKYTTYSVKARQLKFFEENMN    771 - 840
F//

Text Mined References (28)

PMID Year Title