Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.63
PubTator Score 9.90

Knowledge Summary

Patent (2,497)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.7391041247319E-15
atypical teratoid / rhabdoid tumor 4369 1.96628331702268E-8
ovarian cancer 8492 6.23921296467759E-7
tuberculosis and treatment for 3 months 327 5.52233559541463E-6
lung adenocarcinoma 2714 2.67518564073983E-5
Pick disease 1893 2.9211099817685E-5
Breast cancer 3099 2.92222094151309E-5
glioblastoma 5572 9.04065489883421E-5
osteosarcoma 7933 1.56769921550404E-4
primitive neuroectodermal tumor 3031 1.93252221229739E-4
psoriasis 6685 3.2148602933924E-4
medulloblastoma, large-cell 6234 3.9509657121475E-4
medulloblastoma 1524 0.00152131396381033
chronic lymphocytic leukemia 244 0.00341535701678119
progressive supranuclear palsy 674 0.00959148109527318
esophageal adenocarcinoma 737 0.0300884300587873
gastric carcinoma 832 0.0465416709224193

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.074 0.003
esophageal adenocarcinoma 1.100 0.030
psoriasis -1.800 0.000
osteosarcoma -1.684 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.000
medulloblastoma 1.100 0.002
medulloblastoma, large-cell 1.200 0.000
primitive neuroectodermal tumor 1.600 0.000
tuberculosis and treatment for 3 months 1.300 0.000
non-small cell lung cancer -1.026 0.000
lung adenocarcinoma -1.133 0.000
Pick disease -2.200 0.000
progressive supranuclear palsy -2.100 0.010
gastric carcinoma 1.100 0.047
ovarian cancer -1.300 0.000
Breast cancer -1.100 0.000

Synonym

Accession P51956 A8K2J4 Q5TAP2 Q8J023 Q8WUN5
Symbols HSPK36

Gene

PANTHER Protein Class (3)

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (5)

PMID Text
21756249 EHD2 interacts with Nek3 [NIMA (never in mitosis in Aspergillus nidulans)-related kinase 3], a serine/threonine kinase.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17297458 Nek3 contributes to prolactin-mediated breast cancer motility through mechanisms involving Rac1 activation and paxillin phosphorylation.
17118778 Nek3 insertion/deletion polymorphism with alterations at 13q14 is associated with cancers
12063396 Molecular cloning and characterization of the human NIMA-related protein kinase 3 gene (NEK3).

AA Sequence

MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFE      1 - 70
AEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGK     71 - 140
VKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNL    141 - 210
ILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEE    211 - 280
IKNSKHNTPRKKTNPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHL    281 - 350
RKASSPNLHRRQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK    351 - 420
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDW    421 - 490
VSELKKRAGWQGLCDR                                                          491 - 506
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21756249 2011 EHD2 mediates trafficking from the plasma membrane by modulating Rac1 activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17297458 2007 Nek3 kinase regulates prolactin-mediated cytoskeletal reorganization and motility of breast cancer cells.
17118778 2006 Is there any association between nek3 and cancers with frequent 13q14 deletion?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15618286 2005 Novel association of Vav2 and Nek3 modulates signaling through the human prolactin receptor.
More...