Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
R01 Count 13
Funding $376,385.66
PubMed Score 8.63
PubTator Score 9.90

Knowledge Summary

Patent (2,497)

Expression

  Differential Expression (17)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.074 0.003
esophageal adenocarcinoma 1.100 0.030
psoriasis -1.800 0.000
osteosarcoma -1.684 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.000
medulloblastoma 1.100 0.002
medulloblastoma, large-cell 1.200 0.000
primitive neuroectodermal tumor 1.600 0.000
tuberculosis and treatment for 3 months 1.300 0.000
non-small cell lung cancer -1.026 0.000
lung adenocarcinoma -1.133 0.000
Pick disease -2.200 0.000
progressive supranuclear palsy -2.100 0.010
gastric carcinoma 1.100 0.047
ovarian cancer -1.300 0.000
Breast cancer -1.100 0.000

Gene RIF (5)

PMID Text
21756249 EHD2 interacts with Nek3 [NIMA (never in mitosis in Aspergillus nidulans)-related kinase 3], a serine/threonine kinase.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17297458 Nek3 contributes to prolactin-mediated breast cancer motility through mechanisms involving Rac1 activation and paxillin phosphorylation.
17118778 Nek3 insertion/deletion polymorphism with alterations at 13q14 is associated with cancers
12063396 Molecular cloning and characterization of the human NIMA-related protein kinase 3 gene (NEK3).

AA Sequence

MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFE      1 - 70
AEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGK     71 - 140
VKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNL    141 - 210
ILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEE    211 - 280
IKNSKHNTPRKKTNPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHL    281 - 350
RKASSPNLHRRQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK    351 - 420
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDW    421 - 490
VSELKKRAGWQGLCDR                                                          491 - 506
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21756249 2011 EHD2 mediates trafficking from the plasma membrane by modulating Rac1 activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17297458 2007 Nek3 kinase regulates prolactin-mediated cytoskeletal reorganization and motility of breast cancer cells.
17118778 2006 Is there any association between nek3 and cancers with frequent 13q14 deletion?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15618286 2005 Novel association of Vav2 and Nek3 modulates signaling through the human prolactin receptor.
More...