Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.63
PubTator Score 9.90

Knowledge Summary

Patent (2,497)

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.0e-08
Breast cancer -1.100 2.9e-05
Chronic Lymphocytic Leukemia 1.074 3.4e-03
esophageal adenocarcinoma 1.100 3.0e-02
gastric carcinoma 1.100 4.7e-02
glioblastoma 1.100 9.0e-05
lung adenocarcinoma -1.133 2.7e-05
medulloblastoma 1.100 1.5e-03
medulloblastoma, large-cell 1.200 4.0e-04
non-small cell lung cancer -1.026 1.7e-15
osteosarcoma -1.684 1.6e-04
ovarian cancer -1.300 6.2e-07
Pick disease -1.200 3.5e-04
primitive neuroectodermal tumor 1.600 1.9e-04
progressive supranuclear palsy -1.200 1.7e-02
psoriasis -1.800 3.2e-04
tuberculosis 1.200 2.2e-06

Gene RIF (6)

AA Sequence

MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFE      1 - 70
AEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGK     71 - 140
VKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNL    141 - 210
ILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEE    211 - 280
IKNSKHNTPRKKTNPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHL    281 - 350
RKASSPNLHRRQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK    351 - 420
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDW    421 - 490
VSELKKRAGWQGLCDR                                                          491 - 506
//

Text Mined References (21)

PMID Year Title