Property Summary

NCBI Gene PubMed Count 91
PubMed Score 141.20
PubTator Score 119.47

Knowledge Summary

Patent (11,248)

TINX Plot

  Disease Sources (4)

Disease Target Count
Retinitis pigmentosa 67 1
Disease Target Count P-value
psoriasis 6685 2.09317835231015E-115
breast carcinoma 1614 1.04810108778018E-48
non-small cell lung cancer 2798 1.67263317856697E-34
Breast cancer 3099 9.59969916268128E-31
ovarian cancer 8492 1.25374146864378E-10
lung adenocarcinoma 2714 1.20199770302956E-7
lung cancer 4473 1.44092291789295E-7
pancreatic cancer 2300 1.24800730647864E-6
medulloblastoma, large-cell 6234 2.18759268397519E-6
malignant mesothelioma 3163 2.7837439883172E-6
posterior fossa group B ependymoma 1530 3.48980247017501E-6
group 3 medulloblastoma 2254 5.90584651618082E-6
invasive ductal carcinoma 2950 7.82785188825876E-6
Atopic dermatitis 944 4.41972116119779E-5
adrenocortical carcinoma 1427 8.45441921358985E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.53616584964696E-4
ductal carcinoma in situ 1745 0.00107005255673441
atypical teratoid/rhabdoid tumor 1095 0.00144935550282321
primitive neuroectodermal tumor 3031 0.00168499117308439
nasopharyngeal carcinoma 1056 0.00232324269562806
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00349145304168847
glioblastoma 5572 0.00464767652597078
primary Sjogren syndrome 789 0.00485150560785398
astrocytic glioma 2241 0.0110310129704729
Endometriosis 535 0.0114232584166411
oligodendroglioma 2849 0.011478518665395
esophageal adenocarcinoma 737 0.0207859286598439
pilocytic astrocytoma 3086 0.0295674601344584
colon cancer 1475 0.0404285573427822
pediatric high grade glioma 2712 0.0483665809777178
Disease Target Count Z-score Confidence
Cancer 2346 3.735 1.9
Disease Target Count
Retinitis pigmentosa 156

Expression

Synonym

Accession P51955 Q53FD6 Q5I1Z9 Q5VXZ1 Q6NZX8 Q7Z634 Q86XH2 Q96QN9
Symbols NLK1
RP67
NEK2A
HsPK21
PPP1R111

Gene

PANTHER Protein Class (3)

PDB

2JAV   2W5A   2W5B   2W5H   2WQO   2XK3   2XK4   2XK6   2XK7   2XK8   2XKC   2XKD   2XKE   2XKF   2XNM   2XNN   2XNO   2XNP   4A4X   4AFE  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
S.cerevisiae EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (65)

PMID Text
26851035 Hepatocellular carcinoma patients with high NEK2 expression had significantly poor recurrence-free survival (p=0.042) and early recurrence after hepatectomy.
26823916 Suggest elevated Nek2 protein expression may be an independent risk factor for colon cancer.
26320076 The results suggest that overexpression of NEK2 has the potential to serve as a biomarker for PCa prognosis.
26290419 Kif24 is a physiological substrate of Nek2, which regulates cilia disassembly through a concerted mechanism involving Kif24-mediated microtubule depolymerization.
26220856 Cep85 is a bona fide Nek2A-binding partner that surrounds the proximal ends of centrioles where it cooperates with PP1gamma (also known as PPP1CC) to antagonize Nek2A
25705694 we highlight recent findings on the aberrant expression and functional significance of NEK2A in human cancers and emphasize their significance for therapeutic potentials.
25704143 Nek2 was demonstrated to phosphorylate Cep68 in vivo and this phosphorylation appears to promote Cep68 degradation in mitosis.
25673878 Nek2A is degraded in mitosis regardless of enforced spindle checkpoint activation
25313354 Nek2 plays a central role in proteasome-mediated cell cycle regulation and in conferring resistance to bortezomib in cancer cells.
25230277 Findings are consistent with the hypothesis that NEK2 contributes to ALDH1A1-dependent drug resistance in myeloma
More...

AA Sequence

MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRY      1 - 70
YDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHR     71 - 140
DLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELC    141 - 210
ALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQR    211 - 280
RNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAEN    281 - 350
LLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA    351 - 420
QLRAQALSDIEKNYQLKSRQILGMR                                                 421 - 445
//

Text Mined References (100)

PMID Year Title
26851035 2016 High NEK2 Expression Is a Predictor of Tumor Recurrence in Hepatocellular Carcinoma Patients After Hepatectomy.
26823916 2015 Clinical significance and prognostic value of Nek2 protein expression in colon cancer.
26471995 2015 Characterization of Cep85 - a new antagonist of Nek2A that is involved in the regulation of centrosome disjunction.
26320076 2015 Overexpression of NIMA-related kinase 2 is associated with progression and poor prognosis of prostate cancer.
26290419 2015 Nek2 activation of Kif24 ensures cilium disassembly during the cell cycle.
26220856 2015 Characterization of Cep85 - a new antagonist of Nek2A that is involved in the regulation of centrosome disjunction.
25705694 2015 Role of NEK2A in human cancer and its therapeutic potentials.
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25673878 2015 Nek2A destruction marks APC/C activation at the prophase-to-prometaphase transition by spindle-checkpoint-restricted Cdc20.
25313354 2014 Inhibition of Nek2 by small molecules affects proteasome activity.
More...