Property Summary

Ligand Count 4
NCBI Gene PubMed Count 104
PubMed Score 135.52
PubTator Score 119.47

Knowledge Summary

Patent (11,248)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 67 5 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.891 1.9
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 2.102 8.5e-04
astrocytic glioma -1.500 1.1e-02
Astrocytoma, Pilocytic -1.200 2.9e-02
Atopic dermatitis 2.200 4.4e-05
atypical teratoid / rhabdoid tumor 1.200 3.2e-02
Breast cancer 3.700 9.6e-31
breast carcinoma 2.500 1.0e-48
colon cancer 2.900 4.0e-02
ductal carcinoma in situ 3.100 1.1e-03
Endometriosis 1.303 1.1e-02
esophageal adenocarcinoma 1.300 2.1e-02
glioblastoma 1.500 4.6e-03
group 3 medulloblastoma 2.900 1.0e-02
intraductal papillary-mucinous carcinoma... 2.800 9.5e-04
intraductal papillary-mucinous neoplasm ... 3.600 3.5e-03
invasive ductal carcinoma 3.600 7.8e-06
lung adenocarcinoma 1.200 1.5e-09
lung cancer 3.100 1.0e-05
malignant mesothelioma 1.200 7.2e-05
medulloblastoma, large-cell 1.600 4.7e-02
nasopharyngeal carcinoma 1.400 2.3e-03
non-small cell lung cancer 3.334 1.7e-34
oligodendroglioma -1.600 1.1e-02
ovarian cancer 3.400 1.3e-10
pancreatic cancer 2.000 1.2e-06
pediatric high grade glioma 1.400 4.8e-02
posterior fossa group B ependymoma 1.100 3.5e-06
primary Sjogren syndrome 1.100 4.9e-03
primitive neuroectodermal tumor 1.700 1.5e-02
psoriasis 1.300 2.2e-35

Protein-protein Interaction (2)

Gene RIF (77)

AA Sequence

MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRY      1 - 70
YDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHR     71 - 140
DLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELC    141 - 210
ALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQR    211 - 280
RNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAEN    281 - 350
LLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA    351 - 420
QLRAQALSDIEKNYQLKSRQILGMR                                                 421 - 445
//

Text Mined References (112)

PMID Year Title