Property Summary

NCBI Gene PubMed Count 75
PubMed Score 133.56
PubTator Score 21.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 3.1e-02
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group B 20 4.044 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.200 3.1e-02

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK      1 - 70
EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL     71 - 140
TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM    141 - 210
QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP    211 - 280
QDLAGGYTSSLACHRALQDAFSGLFWQPS                                             281 - 309
//

Text Mined References (82)

PMID Year Title