Property Summary

NCBI Gene PubMed Count 110
Grant Count 115
R01 Count 60
Funding $9,938,003.84
PubMed Score 89.79
PubTator Score 78.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.097 0.002
tuberculosis -1.500 0.000
lung cancer -1.500 0.000
diabetes mellitus -1.100 0.002
Pick disease -1.200 0.004
ovarian cancer 1.400 0.001

Synonym

Accession P51946 Q53X72 Q8TBL9
Symbols CAK
p34
p37
CycH

Gene

PDB

1JKW   1KXU  

Gene RIF (64)

PMID Text
25820824 Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of esophageal squamous cell carcinoma .
24855060 Hemodynamic forces modulate EC proliferative phenotype through the miR-23b/CAK/cyclin H pathway.
24351404 SNPs in CCNH and ABCG2 can modulate the development of severe oxaliplatin-induced peripheral neuropathy.
23982724 When considering all thyroid cancer (DTC) cases, only rs2230641 (CCNH) was associated with DTC risk.
23456497 CCNH and CDK7 may play an important role in the tumorigenesis and development of esophageal squamous cell carcinoma.
20598140 High Cyclin H is associated with gastrointestinal stromal tumours.
20522537 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSV      1 - 70
FKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKAL     71 - 140
EQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPS    141 - 210
QIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC    211 - 280
HSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL                               281 - 323
//

Text Mined References (118)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25820824 2015 Interaction with CCNH/CDK7 facilitates CtBP2 promoting esophageal squamous cell carcinoma (ESCC) metastasis via upregulating epithelial-mesenchymal transition (EMT) progression.
25416956 2014 A proteome-scale map of the human interactome network.
24855060 2014 MicroRNA-23b regulates cyclin-dependent kinase-activating kinase complex through cyclin H repression to modulate endothelial transcription and growth under flow.
24351404 2014 Pharmacogenetic predictors of severe peripheral neuropathy in colon cancer patients treated with oxaliplatin-based adjuvant chemotherapy: a GEMCAD group study.
23982724 2013 The role of CCNH Val270Ala (rs2230641) and other nucleotide excision repair polymorphisms in individual susceptibility to well-differentiated thyroid cancer.
23456497 2013 Low expression of cyclinH and cyclin-dependent kinase 7 can decrease the proliferation of human esophageal squamous cell carcinoma.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...