Property Summary

NCBI Gene PubMed Count 114
PubMed Score 96.27
PubTator Score 78.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 2.0e-03
lung cancer -1.500 4.1e-04
osteosarcoma -1.097 1.6e-03
ovarian cancer -1.200 5.5e-07
Pick disease -1.200 4.5e-03
tuberculosis -1.500 1.0e-05

Protein-protein Interaction (5)

Gene RIF (52)

AA Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSV      1 - 70
FKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKAL     71 - 140
EQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPS    141 - 210
QIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC    211 - 280
HSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL                               281 - 323
//

Text Mined References (122)

PMID Year Title