Property Summary

NCBI Gene PubMed Count 40
Grant Count 21
R01 Count 19
Funding $2,779,972.62
PubMed Score 149.74
PubTator Score 38.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26504022 Loss of CNN1 expression is associated with Ovarian Cancer.
26343330 Loss of myoepithelial calponin was specifically associated with gain of the basal marker p63 in adjacent tumor cells.
24631115 epsilonPKC/ERK/mTOR pathway activation induced by the rescued expression of CNN1 contributed to the improvement of cardiac dysfunction and pathological changes observed in transgenic mice.
24350264 Calponin knockdown inhibits autophosphorylation.
24117680 CNN1 immunohistochemical staining allows ready recognition of intracytoplasmic inclusions, aiding diagnosis of infantile digital fibromatosis.
23731614 Expression of transforming growth factor-beta (4.3 +/- 1.4 vs 2.6 +/- 2.3, p = 0.01) and calponin (3.7 +/- 0.7 vs 0.6 +/- 1.1, p = 0.05) was lower from infants with vs without a PDA.
21817093 A single intronic CArG element is necessary but insufficient for proper CNN1 expression in vivo. CNN1 overexpression antagonizes arterial injury-induced neointimal formation.
21326813 D2-40 immunohistochemistry reliably identifies the myoepithelial cells of breast in a variety of lesions in a pattern similar to that of calponin and p63.
21051832 Calponin-1 expression in the uterine smooth muscle tissue of the body and the lower uterine segment of smooth muscle tissues was significantly different.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG      1 - 70
SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV     71 - 140
GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT    141 - 210
NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE    211 - 280
LGEPAHNHHAHNYYNSA                                                         281 - 297
//

Text Mined References (42)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26504022 2015 Identification of the Critical Site of Calponin 1 for Suppression of Ovarian Cancer Properties.
26343330 2015 Myoepithelial cell differentiation markers in ductal carcinoma in situ progression.
26315405 2015 XBP 1-Deficiency Abrogates Neointimal Lesion of Injured Vessels Via Cross Talk With the PDGF Signaling.
24631115 2014 Calponin1 inhibits dilated cardiomyopathy development in mice through the ?PKC pathway.
24350264 2013 Regulation of PKC autophosphorylation by calponin in contractile vascular smooth muscle tissue.
24117680 2014 Anti-calponin 1 antibodies highlight intracytoplasmic inclusions of infantile digital fibromatosis.
23731614 2013 Hypertensive changes within the aortic arch of infants and children with isolated coarctation.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21817093 2011 Smooth muscle calponin: an unconventional CArG-dependent gene that antagonizes neointimal formation.
More...