Property Summary

NCBI Gene PubMed Count 41
PubMed Score 158.78
PubTator Score 38.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -4.100 4.3e-78
breast carcinoma -2.100 6.1e-04
colon cancer -2.700 6.2e-05
cystic fibrosis -2.225 9.2e-07
Endometriosis -1.755 2.9e-02
intraductal papillary-mucinous carcinoma... -1.300 6.0e-04
invasive ductal carcinoma -1.209 2.6e-03
lung adenocarcinoma -1.700 7.5e-05
non diabetic and post-ischemic heart fai... -1.700 3.6e-03
non-small cell lung cancer -1.225 2.1e-09
pancreatic cancer 1.400 1.0e-02
primary pancreatic ductal adenocarcinoma 1.459 1.5e-02
psoriasis -1.800 1.5e-04
type II diabetes mellitus and post-ische... -1.500 3.7e-02

Gene RIF (20)

AA Sequence

MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG      1 - 70
SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV     71 - 140
GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT    141 - 210
NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE    211 - 280
LGEPAHNHHAHNYYNSA                                                         281 - 297
//

Text Mined References (43)

PMID Year Title