Property Summary

NCBI Gene PubMed Count 21
PubMed Score 34.24
PubTator Score 22.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.74142852042237E-18
lung adenocarcinoma 2714 3.34863058570212E-12
non-small cell lung cancer 2798 2.23047414323589E-11
posterior fossa group A ependymoma 1511 8.11463448585996E-9
pituitary cancer 1972 3.63564333067767E-7
adrenocortical carcinoma 1427 7.7088562579633E-6
lung cancer 4473 6.34829741192755E-5
osteosarcoma 7933 4.63683248800231E-4
ductal carcinoma in situ 1745 4.78842540007097E-4
primary pancreatic ductal adenocarcinoma 1271 5.7573916684776E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.81541807870652E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.78714884775564E-4
pancreatic cancer 2300 0.00145304371791715
psoriasis 6685 0.0019983064695629
Atopic dermatitis 944 0.00204558455234398
fibroadenoma 557 0.00420498029974608
invasive ductal carcinoma 2950 0.0043000842995296
breast carcinoma 1614 0.00570246478147973
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00716373369753383
Pick disease 1893 0.00750636809156739
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00814388828950866
progressive supranuclear palsy 674 0.0156362125245786
sonic hedgehog group medulloblastoma 1482 0.0161569011014269
ovarian cancer 8492 0.0240116819594186
colon cancer 1475 0.026504993294239
type II diabetes mellitus and post-ischemic heart failure 89 0.0311693484902381
non diabetic and post-ischemic heart failure 200 0.031382076933017
adrenocortical adenoma 134 0.0335764011203939
non primary Sjogren syndrome sicca 840 0.0346739623916722
Alzheimer's disease 644 0.0462105221448539
Disease Target Count Z-score Confidence
Normal pressure hydrocephalus 10 3.405 1.7

Expression

Synonym

Accession P51888 Q6FG38
Symbols MST161
SLRR2A
MSTP161

Gene

PANTHER Protein Class (1)

  Ortholog (10)

 CSPA Cell Line (1)

Gene RIF (7)

PMID Text
23826326 The unique expression of a 38 kDa PRELP in chronic lymphocytic leukemia (CLL) cells may suggest involvement in the pathobiology of CLL
23442027 PRELP expression governs stem cells to differentiate into ligament tissue in a mouse model.
22267731 PRELP may down-regulate complement attack at basement membranes and on damaged cartilage and therefore limit pathological complement activation in inflammatory disease such as RA.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
17123807 PRELP overexpression leads to a connective tissue phenotype in the skin, where the organization of collagen fibrils in the dermis was perturbed and the thickness of the hypodermal fat layer was diminished.
17093390 Relative abundance of PRELP mRNA and protein inhuman sclera, and observed age-related variation in scleral PRELP expression suggests that PRELP may play critical role in regulating biomechanical properties of scleral extracellular matrix.

AA Sequence

MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF      1 - 70
PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK     71 - 140
IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG    141 - 210
VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD    211 - 280
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP    281 - 350
HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI                                          351 - 382
//

Text Mined References (23)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
23826326 2013 A proline/arginine-rich end leucine-rich repeat protein (PRELP) variant is uniquely expressed in chronic lymphocytic leukemia cells.
23442027 2013 Proline/arginine-rich end leucine-rich repeat protein converts stem cells to ligament tissue and Zn(II) influences its nuclear expression.
22267731 2012 PRELP protein inhibits the formation of the complement membrane attack complex.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...