Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.12
PubTator Score 22.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

 CSPA Cell Line (1)

Protein-protein Interaction (6)

Gene RIF (10)

AA Sequence

MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF      1 - 70
PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK     71 - 140
IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG    141 - 210
VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD    211 - 280
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP    281 - 350
HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI                                          351 - 382
//

Text Mined References (28)

PMID Year Title