Property Summary

NCBI Gene PubMed Count 83
Grant Count 159
R01 Count 126
Funding $17,824,773.85
PubMed Score 509.36
PubTator Score 108.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (38)

Synonym

Accession P51884 B2R6R5 Q96QM7
Symbols LDC
SLRR2D

Gene

LUM

PANTHER Protein Class (1)

Gene RIF (64)

PMID Text
26351669 fibroblasts stimulated with the fibrocyte-secreted inflammatory signal tumor necrosis factor-alpha secrete the small leucine-rich proteoglycan lumican.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
24956166 This meta-analysis suggests that LUM polymorphisms are associated with the risk of high myopia.
24927138 This meta-analysis has suggested that there is a lack of association of the rs3759223 polymorphism with high myopia risk.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 The results suggest that regions within LUM is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24516061 meta-analysis, including 1,545 subjects from 5 studies, indicated that Chinese lumican rs3759223 C allele carriers had a decreased risk of high myopia in comparison to T allele carriers
24367547 Lumican binds ALK5 to promote epithelium wound healing
24061151 This meta-analysis showed the evidence that SNP rs3759223 may affect individual susceptibility to high myopia in the Chinese population.
23846574 lumican may be involved in cell growth and invasion through the regulation of 24 proteins expressed in pancreatic ductal adenocarcinoma.
More...

AA Sequence

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY      1 - 70
LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE     71 - 140
DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL    141 - 210
YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY    211 - 280
LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN                281 - 338
//

Text Mined References (88)

PMID Year Title
26351669 2015 TNF-?-stimulated fibroblasts secrete lumican to promote fibrocyte differentiation.
25304424 2014 Lumican: a new inhibitor of matrix metalloproteinase-14 activity.
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
24956166 2014 Meta-analysis of the association between lumican gene polymorphisms and susceptibility to high Myopia.
24927138 2014 Lack of association between LUM rs3759223 polymorphism and high myopia.
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24516061 2014 Association between a lumican promoter polymorphism and high myopia in the Chinese population: a meta-analysis of case-control studies.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24367547 2013 Lumican binds ALK5 to promote epithelium wound healing.
More...