Property Summary

NCBI Gene PubMed Count 91
PubMed Score 535.76
PubTator Score 108.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 1.4e-22
juvenile dermatomyositis 1187 1.1e-10
Duchenne muscular dystrophy 601 3.5e-09
malignant mesothelioma 3232 9.7e-07
cystic fibrosis 1696 1.1e-06
ulcerative colitis 1819 5.3e-06
Breast cancer 3578 6.0e-06
pancreatic cancer 2398 3.7e-05
primary Sjogren syndrome 735 1.1e-04
limb girdle muscular dystrophy 2A 213 2.3e-04
lung cancer 4740 2.5e-04
Astrocytoma, Pilocytic 3081 4.7e-04
ovarian cancer 8520 9.1e-04
posterior fossa group A ependymoma 468 9.3e-04
fascioscapulohumeral muscular dystrophy 100 2.2e-03
subependymal giant cell astrocytoma 2287 2.5e-03
primary pancreatic ductal adenocarcinoma 1109 2.5e-03
pituitary cancer 1972 2.7e-03
glioblastoma 5792 2.7e-03
gastric carcinoma 807 4.4e-03
adrenocortical carcinoma 1428 4.7e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 6.6e-03
osteosarcoma 7950 7.2e-03
urothelial carcinoma 318 8.5e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 8.6e-03
Amyotrophic lateral sclerosis 451 9.1e-03
acute quadriplegic myopathy 1158 9.4e-03
medulloblastoma, large-cell 6241 1.1e-02
head and neck cancer and chronic obstructive pulmonary disease 239 1.3e-02
adrenocortical adenoma 131 1.5e-02
diabetes mellitus 1728 1.8e-02
nasopharyngeal carcinoma 1058 1.8e-02
esophageal adenocarcinoma 737 1.9e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 2.0e-02
aldosterone-producing adenoma 665 2.1e-02
medulloblastoma 720 2.6e-02
adult high grade glioma 3801 3.0e-02
hereditary spastic paraplegia 318 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (38)

Disease log2 FC p
acute quadriplegic myopathy 1.626 9.4e-03
adrenocortical adenoma -1.554 1.5e-02
adrenocortical carcinoma -2.952 4.7e-03
adult high grade glioma 1.400 3.0e-02
aldosterone-producing adenoma -1.204 2.1e-02
Amyotrophic lateral sclerosis 1.035 9.1e-03
Astrocytoma, Pilocytic 2.000 4.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.878 2.0e-02
Breast cancer 2.100 6.0e-06
cystic fibrosis -2.286 1.1e-06
diabetes mellitus -1.700 1.8e-02
Duchenne muscular dystrophy 2.995 3.5e-09
esophageal adenocarcinoma 2.100 1.9e-02
fascioscapulohumeral muscular dystrophy 1.339 2.2e-03
gastric carcinoma 2.100 4.4e-03
glioblastoma 1.600 2.7e-03
head and neck cancer and chronic obstruc... 1.100 1.3e-02
hereditary spastic paraplegia -1.265 4.8e-02
intraductal papillary-mucinous adenoma (... -2.600 6.6e-03
intraductal papillary-mucinous carcinoma... -3.100 8.6e-03
juvenile dermatomyositis 2.372 1.1e-10
limb girdle muscular dystrophy 2A 2.041 2.3e-04
lung cancer -1.400 2.5e-04
lung carcinoma -3.600 1.4e-22
malignant mesothelioma -1.800 9.7e-07
medulloblastoma 1.700 2.6e-02
medulloblastoma, large-cell 2.100 1.1e-02
nasopharyngeal carcinoma 1.200 1.8e-02
osteosarcoma 1.836 7.2e-03
ovarian cancer -3.700 9.1e-04
pancreatic cancer 2.900 3.7e-05
pituitary cancer -2.000 2.7e-03
posterior fossa group A ependymoma 1.900 9.3e-04
primary pancreatic ductal adenocarcinoma 2.318 2.5e-03
primary Sjogren syndrome 1.900 1.1e-04
subependymal giant cell astrocytoma 6.984 2.5e-03
ulcerative colitis 3.500 5.3e-06
urothelial carcinoma 2.900 8.5e-03

Protein-protein Interaction (5)

Gene RIF (70)

AA Sequence

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY      1 - 70
LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE     71 - 140
DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL    141 - 210
YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY    211 - 280
LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN                281 - 338
//

Text Mined References (96)

PMID Year Title