Property Summary

NCBI Gene PubMed Count 48
Grant Count 30
R01 Count 20
Funding $3,580,709.11
PubMed Score 92.59
PubTator Score 13.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.900 0.002
active Crohn's disease 1.402 0.016
lung carcinoma -1.200 0.000
ulcerative colitis 2.400 0.000
psoriasis 5.500 0.000

Gene RIF (37)

PMID Text
26884849 CASP5 gene overexpression significantly promoted angiogenesis ability of HMEC-1 cells, which was probably achieved by inhibiting angpt-1/Tie2 and promoting VEGF-1 signal pathway.
26508369 Caspase-4 and caspase-5 mediate IL-1alpha and IL-1beta release from human monocytes after lipopolysaccharides stimulation.
26173988 both caspase-4 and caspase-5 are functionally important for appropriate responses to intracellular Gram-negative bacteria.
25943872 this study has identified epithelial-expressed caspases-4 and -5 as biomarkers with diagnostic and therapeutic potential in colorectal cancer.
25753570 The distribution of the other genotypes; rs507879, rs518604 and rs523104 of caspase-5) was not significantly different between patients with psoriasis vulgaris and the healthy controls.
22906436 Data show that exposure of hepatocytes to direct hypoxia resulted in acid sphingomyelinase activation and ceramide elevation associated with activation of caspase 5 and the subsequent cleavage of HuR and apoptotic cell death.
21969293 Mutual activation between caspase-5 and -1 suggests caspase-5 may work predominantly in concert with caspase-1 in modulating retinal pigment epithelium inflammatory responses.
21700414 Association of death receptor 4, Caspase 3 and 5 gene polymorphism with increased risk to bladder cancer in North Indians.
21668377 Data suggest a positive association of caspase-3 and diplotype analysis of caspase-5 to be associated with prostate cancer risk.
21454616 analysis of concerted antigen processing of a short viral antigen by human caspase-5 and -10
More...

AA Sequence

MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVK      1 - 70
MLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKI     71 - 140
TSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARN    141 - 210
GAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKK    211 - 280
KKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCK    281 - 350
IHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE    351 - 420
RATLTRDFYLFPGN                                                            421 - 434
//

Text Mined References (52)

PMID Year Title
26884849 2015 Effects of CASP5 gene overexpression on angiogenesis of HMEC-1 cells.
26508369 2015 Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.
26173988 2015 NLRP3 inflammasome activation downstream of cytoplasmic LPS recognition by both caspase-4 and caspase-5.
25943872 2015 Altered expression of caspases-4 and -5 during inflammatory bowel disease and colorectal cancer: Diagnostic and therapeutic potential.
25753570 2015 Association of angiopoietin-1, angiopoietin-2 and caspase-5 polymorphisms with psoriasis vulgaris.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22906436 2012 The role of acid sphingomyelinase and caspase 5 in hypoxia-induced HuR cleavage and subsequent apoptosis in hepatocytes.
21969293 2011 Expression and functional roles of caspase-5 in inflammatory responses of human retinal pigment epithelial cells.
21700414 2011 Association of death receptor 4, Caspase 3 and 5 gene polymorphism with increased risk to bladder cancer in North Indians.
21668377 2012 Association of caspases with an increased prostate cancer risk in north Indian population.
More...