Property Summary

Ligand Count 4
NCBI Gene PubMed Count 51
PubMed Score 96.05
PubTator Score 13.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.0e-113
lung carcinoma 2843 5.8e-12
ulcerative colitis 1819 1.4e-04
colon cancer 1478 1.7e-03
active Crohn's disease 922 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.222 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.402 1.6e-02
colon cancer -1.900 1.7e-03
lung carcinoma -1.200 5.8e-12
psoriasis 5.500 1.0e-113
ulcerative colitis 1.900 1.4e-04

Gene RIF (39)

AA Sequence

MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVK      1 - 70
MLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKI     71 - 140
TSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARN    141 - 210
GAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKK    211 - 280
KKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCK    281 - 350
IHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE    351 - 420
RATLTRDFYLFPGN                                                            421 - 434
//

Text Mined References (56)

PMID Year Title