Property Summary

NCBI Gene PubMed Count 11
Grant Count 124
R01 Count 56
Funding $14,602,452.63
PubMed Score 474.59
PubTator Score 1022.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -6.100 0.000
osteosarcoma -3.691 0.000
glioblastoma -1.500 0.022
medulloblastoma -1.100 0.017
colon cancer -1.800 0.015
lung cancer -1.900 0.000
lung carcinoma -2.600 0.000

Synonym

Accession P51861 Q5JXH6
Symbols CDR
CDR34
CDR62A

Gene

Gene RIF (5)

PMID Text
26683098 Underexpression of CDR1 is associated with glioblastoma multiforme.
24777548 The results of this case-control study showed that the CDR1 gene was over-expressed in five out of seven subjects with AD compared to seven age- and sex-matched normal controls. Data suggest that CDR1 gene may play a role, in Alzheimer's disease process.
24366849 The CDR1 gene was overexpressed in the LNCaP and PC-3 PCa cell lines as compared with the PNT1A normal prostate cell line.
23555966 Treatment of systemic lupus erythematosus afflicted (NZBxNZW)F1 mice with human CDR1 down regulated gene expression of IFN-alpha.
21964070 miR-671 directs cleavage of a circular antisense transcript of the Cerebellar Degeneration-Related protein 1 (CDR1) locus in an Ago2-slicer-dependent manner.

AA Sequence

MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFS      1 - 70
EAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCG     71 - 140
FSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSG    141 - 210
RCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI                      211 - 262
//

Text Mined References (13)

PMID Year Title
26683098 2016 Dysregulated miR-671-5p / CDR1-AS / CDR1 / VSNL1 axis is involved in glioblastoma multiforme.
25416956 2014 A proteome-scale map of the human interactome network.
24777548 2014 Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in Alzheimer's disease.
24366849 2014 Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in prostate cancer cell lines.
23555966 2013 The tolerogenic peptide, hCDR1, down-regulates the expression of interferon-? in murine and human systemic lupus erythematosus.
21964070 2011 miRNA-dependent gene silencing involving Ago2-mediated cleavage of a circular antisense RNA.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11846061 2001 Expression of Cdx1 and Cdx2 mRNAs and relevance of this expression to differentiation in human gastrointestinal mucosa--with special emphasis on participation in intestinal metaplasia of the human stomach.
More...