Property Summary

NCBI Gene PubMed Count 11
PubMed Score 484.70
PubTator Score 1022.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.800 1.5e-02
glioblastoma -1.200 3.1e-03
lung cancer -1.900 9.1e-05
lung carcinoma -2.600 7.5e-30
malignant mesothelioma 1.700 1.9e-05
medulloblastoma -1.100 1.7e-02
osteosarcoma -3.691 4.9e-06
psoriasis -6.100 2.1e-06

Gene RIF (5)

AA Sequence

MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFS      1 - 70
EAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCG     71 - 140
FSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSG    141 - 210
RCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI                      211 - 262
//

Text Mined References (13)

PMID Year Title