Property Summary

NCBI Gene PubMed Count 11
PubMed Score 474.59
PubTator Score 1022.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.46164470663019E-30
psoriasis 6685 2.10490122381928E-6
osteosarcoma 7933 4.88150055581946E-6
malignant mesothelioma 3163 1.86448184385768E-5
lung cancer 4473 9.14884880075469E-5
colon cancer 1475 0.0147257847206525
medulloblastoma 1524 0.0173012580673356
glioblastoma 5572 0.0217602432446154

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -6.100 0.000
osteosarcoma -3.691 0.000
glioblastoma -1.500 0.022
medulloblastoma -1.100 0.017
colon cancer -1.800 0.015
lung cancer -1.900 0.000
lung carcinoma -2.600 0.000

Gene RIF (5)

PMID Text
26683098 Underexpression of CDR1 is associated with glioblastoma multiforme.
24777548 The results of this case-control study showed that the CDR1 gene was over-expressed in five out of seven subjects with AD compared to seven age- and sex-matched normal controls. Data suggest that CDR1 gene may play a role, in Alzheimer's disease process.
24366849 The CDR1 gene was overexpressed in the LNCaP and PC-3 PCa cell lines as compared with the PNT1A normal prostate cell line.
23555966 Treatment of systemic lupus erythematosus afflicted (NZBxNZW)F1 mice with human CDR1 down regulated gene expression of IFN-alpha.
21964070 miR-671 directs cleavage of a circular antisense transcript of the Cerebellar Degeneration-Related protein 1 (CDR1) locus in an Ago2-slicer-dependent manner.

AA Sequence

MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFS      1 - 70
EAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCG     71 - 140
FSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSG    141 - 210
RCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI                      211 - 262
//

Text Mined References (13)

PMID Year Title
26683098 2016 Dysregulated miR-671-5p / CDR1-AS / CDR1 / VSNL1 axis is involved in glioblastoma multiforme.
25416956 2014 A proteome-scale map of the human interactome network.
24777548 2014 Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in Alzheimer's disease.
24366849 2014 Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in prostate cancer cell lines.
23555966 2013 The tolerogenic peptide, hCDR1, down-regulates the expression of interferon-? in murine and human systemic lupus erythematosus.
21964070 2011 miRNA-dependent gene silencing involving Ago2-mediated cleavage of a circular antisense RNA.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11846061 2001 Expression of Cdx1 and Cdx2 mRNAs and relevance of this expression to differentiation in human gastrointestinal mucosa--with special emphasis on participation in intestinal metaplasia of the human stomach.
More...