Property Summary

NCBI Gene PubMed Count 76
PubMed Score 132.34
PubTator Score 125.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.0e-08
Breast cancer 1.200 1.9e-05
colon cancer 1.100 1.2e-02
glioblastoma 1.100 1.2e-03
group 3 medulloblastoma 1.100 9.5e-04
invasive ductal carcinoma 1.200 7.9e-04
lung cancer 1.500 1.8e-04
medulloblastoma, large-cell 1.500 6.6e-05
osteosarcoma -1.384 2.1e-03
ovarian cancer 2.600 3.4e-08
primitive neuroectodermal tumor 1.100 3.5e-04

Gene RIF (60)

AA Sequence

MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESK      1 - 70
EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLV     71 - 140
IDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGP    141 - 210
PQEEEEEEDEEEEATKEDAEAPGIRDHESL                                            211 - 240
//

Text Mined References (100)

PMID Year Title