Property Summary

NCBI Gene PubMed Count 69
Grant Count 18
R01 Count 18
Funding $1,897,043.1
PubMed Score 125.70
PubTator Score 125.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.384 0.002
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.001
medulloblastoma 1.100 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.100 0.000
lung cancer 1.500 0.000
colon cancer 1.100 0.012
invasive ductal carcinoma 1.200 0.001
ovarian cancer 2.600 0.000
Breast cancer 1.200 0.000

Gene RIF (55)

PMID Text
26845719 describe two previously unknown HDGF isoforms, HDGF-B and HDGF-C, generated via alternative splicing with structurally unrelated N-terminal regions of their hath region
26612514 study uncovers a novel function of HDGF as a messenger of cellular condition (alarmin) which in-turn modulates cellular function-aspects that could be used as a biomarker for ovarian cancer.
26296979 HDGF and beta-catenin interact as a positive feedback loop, which plays an important role in carcinogenesis and progression of colorectal carcinoma.
26081074 HDGF is important in promoting malignant biological behaviors, including proliferation, migration and invasion of hilar cholangiocarcinoma cells.
26067205 HDGF contains conserved N-terminal HATH domains with a characteristic structural motif, namely the PWWP motif. This study defines the role of the first residue of the PWWP motif in modulating HATH domain stability and oligomer formation in binding.
25938538 Hepatoma-derived growth factor overexpression is involved in liver carcinogenesis.
25773828 Meta-analysis results provide evidence that HDGF may be a new indicator of poor cancer prognosis.
25677618 These data suggested that irradiated fibroblasts promoted invasion, growth, EMT and HDGF expression of ESCC.
25421244 HDGF overexpression is common in early-stage cervical adenocarcinoma.
25275311 The expression level of hepatoma-derived growth factor (HDGF) significantly decreased in response to the virus-associated RNAs under replication-deficient condition.
More...

AA Sequence

MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESK      1 - 70
EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLV     71 - 140
IDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGP    141 - 210
PQEEEEEEDEEEEATKEDAEAPGIRDHESL                                            211 - 240
//

Text Mined References (92)

PMID Year Title
26845719 2016 Two new isoforms of the human hepatoma-derived growth factor interact with components of the cytoskeleton.
26612514 2016 Hepatoma derived growth factor (HDGF) dynamics in ovarian cancer cells.
26296979 2015 Positive feedback loop of hepatoma-derived growth factor and ?-catenin promotes carcinogenesis of colorectal cancer.
26081074 2015 Downregulation of the expression of HDGF attenuates malignant biological behaviors of hilar cholangiocarcinoma cells.
26067205 2015 The First Residue of the PWWP Motif Modulates HATH Domain Binding, Stability, and Protein-Protein Interaction.
25938538 2015 Hepatoma-derived growth factor/nucleolin axis as a novel oncogenic pathway in liver carcinogenesis.
25773828 2015 Prognostic role of hepatoma-derived growth factor in solid tumors of Eastern Asia: a systematic review and meta- analysis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25677618 2015 Irradiated fibroblasts promote epithelial-mesenchymal transition and HDGF expression of esophageal squamous cell carcinoma.
25421244 2014 Hepatoma-derived growth factor upregulation is correlated with prognostic factors of early-stage cervical adenocarcinoma.
More...