Property Summary

NCBI Gene PubMed Count 32
PubMed Score 75.68
PubTator Score 51.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.757 2.1e-02
psoriasis -1.400 5.4e-05

 MGI Phenotype (1)

Protein-protein Interaction (4)

PDB (14)

Gene RIF (20)

AA Sequence

MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIRE      1 - 70
KIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKW     71 - 140
LYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQ    141 - 210
QHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI    211 - 280
KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY                            281 - 326
//

Text Mined References (41)

PMID Year Title