Property Summary

NCBI Gene PubMed Count 48
PubMed Score 445.20
PubTator Score 79.48

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.4635443263206E-11
tuberculosis and treatment for 3 months 327 0.00135182325894689
ovarian cancer 8492 0.0014296506680041
adult high grade glioma 2148 0.00269946029996148
pilocytic astrocytoma 3086 0.0124496238207214


  Differential Expression (5)


Accession P51854 A8K896 Q5TYJ8 Q5TYJ9 Q8TC75
Symbols TKR


PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid

 GWAS Trait (1)

Gene RIF (38)

26907172 Data provide evidence for an important role of TKTL1 in aerobic glycolysis and tumor promotion in melanoma that may result from defective promoter methylation.
26406948 Both TKTL1 and p63 are independent prognostic factors of the poor outcome of gastric cancer patients
26349965 TKTL1 is associated with a more aggressive behavior in human esophageal squamous cell carcinoma cells
26187043 Data revealed exceptional occurrence of TKTL1 in a panel of malignant human cell lines in vitro suggesting that its presence was unrelated to either the rate of glucose consumption/lactic acid production or resistance against chemo- and radiotherapy.
26032094 our results suggest that TKTL1 as a key prognostic factor may be a novel target for therapy of the patients with esophageal squamous cell carcinoma.
25572961 the cytoplasmatic expression of TKTL1 is specific for MIBC tissue compared with histopathologically benign urothelium.
24390277 TKTL1 expression levels appear to decline in the course of CML with lowest levels during blast crisis. A potential reason is a shift of TKTL1-high-expressing mature granulocytes towards TKTL1-low-expressing immature cells and blasts.
24304513 DNASEX and TKTL1 detection in patient blood is associated with poor disease-free survival rate in oral squamous cell carcinoma.
24193262 In 50% of colorectal cancer patients, TKTL1 protein expression was upregulated in tumor compared to non-tumor tissue. TKTL1 expression correlated with HIF-1alpha protein expression and was induced upon hypoxic conditions.
23261987 Data indicate that transketolase (hTKT). shares 61% sequence identity with transketolase-like protein (TKTL1).

AA Sequence

LAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN                                      561 - 596

Text Mined References (49)

PMID Year Title
26907172 2016 Transketolase-like 1 ectopic expression is associated with DNA hypomethylation and induces the Warburg effect in melanoma cells.
26406948 2015 TKTL1 and p63 are biomarkers for the poor prognosis of gastric cancer patients.
26349965 2015 TKTL1 promotes cell proliferation and metastasis in esophageal squamous cell carcinoma.
26187043 2015 TKTL1 expression in human malign and benign cell lines.
26032094 2015 TKTL1 expression and its downregulation is implicated in cell proliferation inhibition and cell cycle arrest in esophageal squamous cell carcinoma.
25572961 2015 Expression patterns and prognostic role of transketolase-like 1 in muscle-invasive bladder cancer.
24390277 2014 Expression of transketolase-like gene 1 (TKTL1) depends on disease phase in patients with chronic myeloid leukaemia (CML).
24304513 2013 A biomarker based detection and characterization of carcinomas exploiting two fundamental biophysical mechanisms in mammalian cells.
24193262 2013 Hypoxia induces the expression of transketolase-like 1 in human colorectal cancer.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.