Property Summary

NCBI Gene PubMed Count 50
PubMed Score 478.27
PubTator Score 79.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.600 2.7e-03
Astrocytoma, Pilocytic 1.200 1.6e-02
ependymoma 2.500 1.9e-05
ovarian cancer 2.200 1.4e-03
tuberculosis -1.400 7.3e-03

Gene RIF (40)

AA Sequence

MADAEARAEFPEEARPDRGTLQVLQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVLFFYIMRYKQS      1 - 70
DPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESSEGSVWEAMAF     71 - 140
ASYYSLDNLVAIFDVNRLGHSGALPAEHCINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQASQVKHKPT    141 - 210
AVVAKTFKGRGTPSIEDAESWHAKPMPRERADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSP    211 - 280
PDYRVGDKIATRKACGLALAKLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGC    281 - 350
ASRGRTIAFASTFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF    351 - 420
YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVIGAGITVYEAL    421 - 490
AAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQGGIGEAVCAAVSMDPDIQVHS    491 - 560
LAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN                                      561 - 596
//

Text Mined References (51)

PMID Year Title